Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 116302..116556 | Replicon | plasmid pE32-2 |
| Accession | NZ_CP119732 | ||
| Organism | Escherichia coli strain E32 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P1J21_RS25980 | Protein ID | WP_001312851.1 |
| Coordinates | 116407..116556 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 116302..116363 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J21_RS25955 (113050) | 113050..113796 | + | 747 | WP_276170845.1 | conjugal transfer pilus acetylase TraX | - |
| P1J21_RS25960 (113855) | 113855..114715 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| P1J21_RS25965 (114818) | 114818..115378 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| P1J21_RS25970 (115514) | 115514..115726 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| P1J21_RS25975 (115972) | 115972..116046 | + | 75 | Protein_122 | endonuclease | - |
| - (116302) | 116302..116363 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (116302) | 116302..116363 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (116302) | 116302..116363 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (116302) | 116302..116363 | - | 62 | NuclAT_1 | - | Antitoxin |
| P1J21_RS25980 (116407) | 116407..116556 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| P1J21_RS25985 (116840) | 116840..117097 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| P1J21_RS25990 (117114) | 117114..117365 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| P1J21_RS25995 (117356) | 117356..117403 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| P1J21_RS26000 (117396) | 117396..117878 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| P1J21_RS26005 (117871) | 117871..118728 | + | 858 | WP_105075777.1 | incFII family plasmid replication initiator RepA | - |
| P1J21_RS26010 (119429) | 119429..119569 | + | 141 | WP_001333237.1 | hypothetical protein | - |
| P1J21_RS26015 (119667) | 119667..120059 | + | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| P1J21_RS26020 (120052) | 120052..120309 | + | 258 | WP_230133887.1 | CPBP family intramembrane metalloprotease | - |
| P1J21_RS26025 (120402) | 120402..120659 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| P1J21_RS26030 (120592) | 120592..120993 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..130351 | 130351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T274323 WP_001312851.1 NZ_CP119732:116407-116556 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT274323 NZ_CP119732:c116363-116302 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
