Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 82512..82938 | Replicon | plasmid pE32-2 |
| Accession | NZ_CP119732 | ||
| Organism | Escherichia coli strain E32 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P1J21_RS25775 | Protein ID | WP_001372321.1 |
| Coordinates | 82813..82938 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 82512..82736 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J21_RS25720 (77888) | 77888..78859 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| P1J21_RS25725 (79496) | 79496..79665 | + | 170 | Protein_72 | hypothetical protein | - |
| P1J21_RS25730 (79848) | 79848..79928 | - | 81 | Protein_73 | hypothetical protein | - |
| P1J21_RS25735 (79998) | 79998..80204 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| P1J21_RS25740 (80230) | 80230..80769 | + | 540 | WP_276170844.1 | single-stranded DNA-binding protein | - |
| P1J21_RS25745 (80837) | 80837..81070 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| P1J21_RS25750 (81098) | 81098..81295 | + | 198 | Protein_77 | hypothetical protein | - |
| P1J21_RS25755 (81350) | 81350..81784 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| P1J21_RS25760 (81781) | 81781..82543 | + | 763 | Protein_79 | plasmid SOS inhibition protein A | - |
| P1J21_RS25765 (82512) | 82512..82700 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (82512) | 82512..82736 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (82512) | 82512..82736 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (82512) | 82512..82736 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (82512) | 82512..82736 | + | 225 | NuclAT_0 | - | Antitoxin |
| P1J21_RS25770 (82722) | 82722..82871 | + | 150 | Protein_81 | plasmid maintenance protein Mok | - |
| P1J21_RS25775 (82813) | 82813..82938 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P1J21_RS25780 (83158) | 83158..83388 | + | 231 | WP_071586998.1 | hypothetical protein | - |
| P1J21_RS25785 (83386) | 83386..83558 | - | 173 | Protein_84 | hypothetical protein | - |
| P1J21_RS25790 (83628) | 83628..83834 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| P1J21_RS25795 (83859) | 83859..84146 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| P1J21_RS25800 (84264) | 84264..85085 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| P1J21_RS25805 (85382) | 85382..85984 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| P1J21_RS25810 (86305) | 86305..86688 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P1J21_RS25815 (86875) | 86875..87564 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..130351 | 130351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T274320 WP_001372321.1 NZ_CP119732:82813-82938 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT274320 NZ_CP119732:82512-82736 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|