Detailed information of TA system TA274320

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 82512..82938
• Replicon: plasmid pE32-2
• Accession: NZ_CP119732
• Organism: Escherichia coli strain E32

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P1J21_RS25775
• Protein ID: WP_001372321.1
• Coordinates: 82813..82938 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	82512..82736 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P1J21_RS25720 (77888)	77888..78859	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
P1J21_RS25725 (79496)	79496..79665	+	170	Protein_72	hypothetical protein	-
P1J21_RS25730 (79848)	79848..79928	-	81	Protein_73	hypothetical protein	-
P1J21_RS25735 (79998)	79998..80204	+	207	WP_000275856.1	hypothetical protein	-
P1J21_RS25740 (80230)	80230..80769	+	540	WP_276170844.1	single-stranded DNA-binding protein	-
P1J21_RS25745 (80837)	80837..81070	+	234	WP_000005987.1	DUF905 family protein	-
P1J21_RS25750 (81098)	81098..81295	+	198	Protein_77	hypothetical protein	-
P1J21_RS25755 (81350)	81350..81784	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
P1J21_RS25760 (81781)	81781..82543	+	763	Protein_79	plasmid SOS inhibition protein A	-
P1J21_RS25765 (82512)	82512..82700	-	189	WP_001299721.1	hypothetical protein	-
- (82512)	82512..82736	+	225	NuclAT_0	-	Antitoxin
- (82512)	82512..82736	+	225	NuclAT_0	-	Antitoxin
- (82512)	82512..82736	+	225	NuclAT_0	-	Antitoxin
- (82512)	82512..82736	+	225	NuclAT_0	-	Antitoxin
P1J21_RS25770 (82722)	82722..82871	+	150	Protein_81	plasmid maintenance protein Mok	-
P1J21_RS25775 (82813)	82813..82938	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
P1J21_RS25780 (83158)	83158..83388	+	231	WP_071586998.1	hypothetical protein	-
P1J21_RS25785 (83386)	83386..83558	-	173	Protein_84	hypothetical protein	-
P1J21_RS25790 (83628)	83628..83834	+	207	WP_000547968.1	hypothetical protein	-
P1J21_RS25795 (83859)	83859..84146	+	288	WP_000107535.1	hypothetical protein	-
P1J21_RS25800 (84264)	84264..85085	+	822	WP_001234426.1	DUF932 domain-containing protein	-
P1J21_RS25805 (85382)	85382..85984	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
P1J21_RS25810 (86305)	86305..86688	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P1J21_RS25815 (86875)	86875..87564	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	oqxA / sitABCD	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..130351	130351

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T274320 WP_001372321.1 NZ_CP119732:82813-82938 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT274320 NZ_CP119732:82512-82736 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin