Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 83076..83502 | Replicon | plasmid pE16-2 |
| Accession | NZ_CP119728 | ||
| Organism | Escherichia coli strain E16 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P1J20_RS25840 | Protein ID | WP_001372321.1 |
| Coordinates | 83076..83201 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 83278..83502 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J20_RS25800 (78450) | 78450..79139 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| P1J20_RS25805 (79326) | 79326..79709 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P1J20_RS25810 (80030) | 80030..80632 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| P1J20_RS25815 (80929) | 80929..81750 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| P1J20_RS25820 (81868) | 81868..82155 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| P1J20_RS25825 (82180) | 82180..82386 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| P1J20_RS25830 (82456) | 82456..82628 | + | 173 | Protein_95 | hypothetical protein | - |
| P1J20_RS25835 (82626) | 82626..82856 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| P1J20_RS25840 (83076) | 83076..83201 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P1J20_RS25845 (83143) | 83143..83292 | - | 150 | Protein_98 | plasmid maintenance protein Mok | - |
| - (83278) | 83278..83502 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (83278) | 83278..83502 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (83278) | 83278..83502 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (83278) | 83278..83502 | - | 225 | NuclAT_0 | - | Antitoxin |
| P1J20_RS25850 (83314) | 83314..83502 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| P1J20_RS25855 (83471) | 83471..84233 | - | 763 | Protein_100 | plasmid SOS inhibition protein A | - |
| P1J20_RS25860 (84230) | 84230..84664 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| P1J20_RS25865 (84719) | 84719..84916 | - | 198 | Protein_102 | hypothetical protein | - |
| P1J20_RS25870 (84944) | 84944..85177 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| P1J20_RS25875 (85245) | 85245..85784 | - | 540 | WP_276170844.1 | single-stranded DNA-binding protein | - |
| P1J20_RS25880 (85810) | 85810..86016 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| P1J20_RS25885 (86086) | 86086..86166 | + | 81 | Protein_106 | hypothetical protein | - |
| P1J20_RS25890 (86349) | 86349..86518 | - | 170 | Protein_107 | hypothetical protein | - |
| P1J20_RS25895 (87155) | 87155..88126 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / oqxB / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..130351 | 130351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T274293 WP_001372321.1 NZ_CP119728:c83201-83076 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT274293 NZ_CP119728:c83502-83278 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|