Detailed information of TA system TA274293

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 83076..83502
• Replicon: plasmid pE16-2
• Accession: NZ_CP119728
• Organism: Escherichia coli strain E16

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P1J20_RS25840
• Protein ID: WP_001372321.1
• Coordinates: 83076..83201 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	83278..83502 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P1J20_RS25800 (78450)	78450..79139	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
P1J20_RS25805 (79326)	79326..79709	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P1J20_RS25810 (80030)	80030..80632	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
P1J20_RS25815 (80929)	80929..81750	-	822	WP_001234426.1	DUF932 domain-containing protein	-
P1J20_RS25820 (81868)	81868..82155	-	288	WP_000107535.1	hypothetical protein	-
P1J20_RS25825 (82180)	82180..82386	-	207	WP_000547968.1	hypothetical protein	-
P1J20_RS25830 (82456)	82456..82628	+	173	Protein_95	hypothetical protein	-
P1J20_RS25835 (82626)	82626..82856	-	231	WP_071586998.1	hypothetical protein	-
P1J20_RS25840 (83076)	83076..83201	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
P1J20_RS25845 (83143)	83143..83292	-	150	Protein_98	plasmid maintenance protein Mok	-
- (83278)	83278..83502	-	225	NuclAT_0	-	Antitoxin
- (83278)	83278..83502	-	225	NuclAT_0	-	Antitoxin
- (83278)	83278..83502	-	225	NuclAT_0	-	Antitoxin
- (83278)	83278..83502	-	225	NuclAT_0	-	Antitoxin
P1J20_RS25850 (83314)	83314..83502	+	189	WP_001299721.1	hypothetical protein	-
P1J20_RS25855 (83471)	83471..84233	-	763	Protein_100	plasmid SOS inhibition protein A	-
P1J20_RS25860 (84230)	84230..84664	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
P1J20_RS25865 (84719)	84719..84916	-	198	Protein_102	hypothetical protein	-
P1J20_RS25870 (84944)	84944..85177	-	234	WP_000005987.1	DUF905 family protein	-
P1J20_RS25875 (85245)	85245..85784	-	540	WP_276170844.1	single-stranded DNA-binding protein	-
P1J20_RS25880 (85810)	85810..86016	-	207	WP_000275856.1	hypothetical protein	-
P1J20_RS25885 (86086)	86086..86166	+	81	Protein_106	hypothetical protein	-
P1J20_RS25890 (86349)	86349..86518	-	170	Protein_107	hypothetical protein	-
P1J20_RS25895 (87155)	87155..88126	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	oqxA / oqxB / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..130351	130351

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T274293 WP_001372321.1 NZ_CP119728:c83201-83076 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT274293 NZ_CP119728:c83502-83278 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin