Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49458..49712 | Replicon | plasmid pE16-2 |
| Accession | NZ_CP119728 | ||
| Organism | Escherichia coli strain E16 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P1J20_RS25635 | Protein ID | WP_001312851.1 |
| Coordinates | 49458..49607 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 49651..49712 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J20_RS25585 (45021) | 45021..45422 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| P1J20_RS25590 (45355) | 45355..45612 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| P1J20_RS25595 (45705) | 45705..46013 | - | 309 | WP_226116723.1 | CPBP family intramembrane metalloprotease | - |
| P1J20_RS25600 (45955) | 45955..46347 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| P1J20_RS25605 (46445) | 46445..46585 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| P1J20_RS25610 (47286) | 47286..48143 | - | 858 | WP_105075777.1 | incFII family plasmid replication initiator RepA | - |
| P1J20_RS25615 (48136) | 48136..48618 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| P1J20_RS25620 (48611) | 48611..48658 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| P1J20_RS25625 (48649) | 48649..48900 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| P1J20_RS25630 (48917) | 48917..49174 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| P1J20_RS25635 (49458) | 49458..49607 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (49651) | 49651..49712 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (49651) | 49651..49712 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (49651) | 49651..49712 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (49651) | 49651..49712 | + | 62 | NuclAT_1 | - | Antitoxin |
| P1J20_RS25640 (49968) | 49968..50042 | - | 75 | Protein_57 | endonuclease | - |
| P1J20_RS25645 (50288) | 50288..50500 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| P1J20_RS25650 (50636) | 50636..51196 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| P1J20_RS25655 (51299) | 51299..52159 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| P1J20_RS25660 (52218) | 52218..52964 | - | 747 | WP_276170845.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / oqxB / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..130351 | 130351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T274289 WP_001312851.1 NZ_CP119728:c49607-49458 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT274289 NZ_CP119728:49651-49712 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
