Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1100611..1101189 Replicon chromosome
Accession NZ_CP119676
Organism Varunaivibrio sulfuroxidans strain TC8

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag P3M64_RS05150 Protein ID WP_132940164.1
Coordinates 1100611..1100892 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID -
Locus tag P3M64_RS05155 Protein ID WP_132940163.1
Coordinates 1100908..1101189 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P3M64_RS05095 (P3M64_05095) 1096820..1097248 + 429 WP_132940173.1 type II toxin-antitoxin system HicB family antitoxin -
P3M64_RS05100 (P3M64_05100) 1097316..1097552 - 237 WP_132940172.1 hypothetical protein -
P3M64_RS05105 (P3M64_05105) 1097594..1097857 + 264 WP_165886415.1 replication initiation protein RepC -
P3M64_RS05110 (P3M64_05110) 1097989..1098267 + 279 WP_243644894.1 type II toxin-antitoxin system RelE/ParE family toxin -
P3M64_RS05115 (P3M64_05115) 1098267..1098590 + 324 WP_132940170.1 HigA family addiction module antitoxin -
P3M64_RS05120 (P3M64_05120) 1098744..1098932 + 189 WP_132940169.1 type II toxin-antitoxin system HicA family toxin -
P3M64_RS05125 (P3M64_05125) 1098938..1099342 + 405 WP_132940168.1 type II toxin-antitoxin system HicB family antitoxin -
P3M64_RS05130 (P3M64_05130) 1099436..1099728 + 293 Protein_1008 type II toxin-antitoxin system RelE/ParE family toxin -
P3M64_RS05135 (P3M64_05135) 1099730..1100050 + 321 WP_132940167.1 putative addiction module antidote protein -
P3M64_RS05140 (P3M64_05140) 1100028..1100264 - 237 WP_132940166.1 hypothetical protein -
P3M64_RS05145 (P3M64_05145) 1100306..1100584 + 279 WP_165886414.1 replication initiation protein RepC -
P3M64_RS05150 (P3M64_05150) 1100611..1100892 + 282 WP_132940164.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P3M64_RS05155 (P3M64_05155) 1100908..1101189 + 282 WP_132940163.1 HigA family addiction module antitoxin Antitoxin
P3M64_RS05160 (P3M64_05160) 1101233..1101508 + 276 WP_132940177.1 BrnT family toxin -
P3M64_RS05165 (P3M64_05165) 1101468..1101758 + 291 WP_132940162.1 helix-turn-helix domain-containing protein -
P3M64_RS05170 (P3M64_05170) 1101782..1102996 - 1215 WP_132940161.1 recombinase family protein -
P3M64_RS05175 (P3M64_05175) 1102929..1103183 - 255 WP_243644900.1 BRO family protein -
P3M64_RS05180 (P3M64_05180) 1103334..1103558 + 225 WP_132940160.1 hypothetical protein -
P3M64_RS05185 (P3M64_05185) 1103743..1104186 - 444 WP_132940159.1 hypothetical protein -
P3M64_RS05190 (P3M64_05190) 1104155..1104436 - 282 WP_132940158.1 hypothetical protein -
P3M64_RS05195 (P3M64_05195) 1104439..1104768 - 330 WP_132940157.1 hypothetical protein -
P3M64_RS05200 (P3M64_05200) 1104964..1105263 + 300 WP_132940156.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1094065..1119589 25524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(1-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(3-80)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11264.94 Da        Isoelectric Point: 9.4662

>T274267 WP_132940164.1 NZ_CP119676:1100611-1100892 [Varunaivibrio sulfuroxidans]
MIKSFHNKETQALFERVRCYRKWRSFERIALRKLVMVHAAKELKDLACPPNNRLEGLKGDRQSQYSIRINQQYRVCFEWK
EGDAYDVEIVDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10184.80 Da        Isoelectric Point: 10.2710

>AT274267 WP_132940163.1 NZ_CP119676:1100908-1101189 [Varunaivibrio sulfuroxidans]
MIFPIHPGEILKNEFMEPLGLSANKLAAALKVPTNRLTGIVGGDRSITADTALRLSDAFGTTPEFWVGLQNHYNLEVARQ
KKRPKIERISAAA

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References