Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1100611..1101189 | Replicon | chromosome |
| Accession | NZ_CP119676 | ||
| Organism | Varunaivibrio sulfuroxidans strain TC8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P3M64_RS05150 | Protein ID | WP_132940164.1 |
| Coordinates | 1100611..1100892 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | P3M64_RS05155 | Protein ID | WP_132940163.1 |
| Coordinates | 1100908..1101189 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3M64_RS05095 (P3M64_05095) | 1096820..1097248 | + | 429 | WP_132940173.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| P3M64_RS05100 (P3M64_05100) | 1097316..1097552 | - | 237 | WP_132940172.1 | hypothetical protein | - |
| P3M64_RS05105 (P3M64_05105) | 1097594..1097857 | + | 264 | WP_165886415.1 | replication initiation protein RepC | - |
| P3M64_RS05110 (P3M64_05110) | 1097989..1098267 | + | 279 | WP_243644894.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P3M64_RS05115 (P3M64_05115) | 1098267..1098590 | + | 324 | WP_132940170.1 | HigA family addiction module antitoxin | - |
| P3M64_RS05120 (P3M64_05120) | 1098744..1098932 | + | 189 | WP_132940169.1 | type II toxin-antitoxin system HicA family toxin | - |
| P3M64_RS05125 (P3M64_05125) | 1098938..1099342 | + | 405 | WP_132940168.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| P3M64_RS05130 (P3M64_05130) | 1099436..1099728 | + | 293 | Protein_1008 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P3M64_RS05135 (P3M64_05135) | 1099730..1100050 | + | 321 | WP_132940167.1 | putative addiction module antidote protein | - |
| P3M64_RS05140 (P3M64_05140) | 1100028..1100264 | - | 237 | WP_132940166.1 | hypothetical protein | - |
| P3M64_RS05145 (P3M64_05145) | 1100306..1100584 | + | 279 | WP_165886414.1 | replication initiation protein RepC | - |
| P3M64_RS05150 (P3M64_05150) | 1100611..1100892 | + | 282 | WP_132940164.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3M64_RS05155 (P3M64_05155) | 1100908..1101189 | + | 282 | WP_132940163.1 | HigA family addiction module antitoxin | Antitoxin |
| P3M64_RS05160 (P3M64_05160) | 1101233..1101508 | + | 276 | WP_132940177.1 | BrnT family toxin | - |
| P3M64_RS05165 (P3M64_05165) | 1101468..1101758 | + | 291 | WP_132940162.1 | helix-turn-helix domain-containing protein | - |
| P3M64_RS05170 (P3M64_05170) | 1101782..1102996 | - | 1215 | WP_132940161.1 | recombinase family protein | - |
| P3M64_RS05175 (P3M64_05175) | 1102929..1103183 | - | 255 | WP_243644900.1 | BRO family protein | - |
| P3M64_RS05180 (P3M64_05180) | 1103334..1103558 | + | 225 | WP_132940160.1 | hypothetical protein | - |
| P3M64_RS05185 (P3M64_05185) | 1103743..1104186 | - | 444 | WP_132940159.1 | hypothetical protein | - |
| P3M64_RS05190 (P3M64_05190) | 1104155..1104436 | - | 282 | WP_132940158.1 | hypothetical protein | - |
| P3M64_RS05195 (P3M64_05195) | 1104439..1104768 | - | 330 | WP_132940157.1 | hypothetical protein | - |
| P3M64_RS05200 (P3M64_05200) | 1104964..1105263 | + | 300 | WP_132940156.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1094065..1119589 | 25524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11264.94 Da Isoelectric Point: 9.4662
>T274267 WP_132940164.1 NZ_CP119676:1100611-1100892 [Varunaivibrio sulfuroxidans]
MIKSFHNKETQALFERVRCYRKWRSFERIALRKLVMVHAAKELKDLACPPNNRLEGLKGDRQSQYSIRINQQYRVCFEWK
EGDAYDVEIVDYH
MIKSFHNKETQALFERVRCYRKWRSFERIALRKLVMVHAAKELKDLACPPNNRLEGLKGDRQSQYSIRINQQYRVCFEWK
EGDAYDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|