Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 189192..189409 | Replicon | chromosome |
Accession | NZ_CP119675 | ||
Organism | Bacillus velezensis strain 160 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A4V7TPQ9 |
Locus tag | PX690_RS01305 | Protein ID | WP_041482523.1 |
Coordinates | 189192..189371 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 189318..189409 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX690_RS01290 (185175) | 185175..187046 | - | 1872 | WP_276123423.1 | hypothetical protein | - |
PX690_RS01295 (187352) | 187352..188569 | - | 1218 | WP_276123424.1 | hypothetical protein | - |
PX690_RS01300 (188650) | 188650..188889 | - | 240 | WP_014472020.1 | hypothetical protein | - |
PX690_RS01305 (189192) | 189192..189371 | - | 180 | WP_041482523.1 | hypothetical protein | Toxin |
- (189318) | 189318..189409 | + | 92 | NuclAT_1 | - | Antitoxin |
- (189318) | 189318..189409 | + | 92 | NuclAT_1 | - | Antitoxin |
- (189318) | 189318..189409 | + | 92 | NuclAT_1 | - | Antitoxin |
- (189318) | 189318..189409 | + | 92 | NuclAT_1 | - | Antitoxin |
PX690_RS01310 (190355) | 190355..191467 | - | 1113 | WP_057080559.1 | tubulin-like doman-containing protein | - |
PX690_RS01315 (191467) | 191467..191751 | - | 285 | WP_276123425.1 | hypothetical protein | - |
PX690_RS01320 (191930) | 191930..192166 | + | 237 | WP_038458718.1 | helix-turn-helix domain-containing protein | - |
PX690_RS01325 (192286) | 192286..192465 | + | 180 | WP_046559799.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 112126..286343 | 174217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 7070.74 Da Isoelectric Point: 12.4499
>T274260 WP_041482523.1 NZ_CP119675:c189371-189192 [Bacillus velezensis]
VLEKVGITIAFLIPITVLIINCLTIAEKIQNLMKNKESKKKKRTRKRLRSKRQRKRIRR
VLEKVGITIAFLIPITVLIINCLTIAEKIQNLMKNKESKKKKRTRKRLRSKRQRKRIRR
Download Length: 180 bp
Antitoxin
Download Length: 92 bp
>AT274260 NZ_CP119675:189318-189409 [Bacillus velezensis]
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATAGCATA
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATAGCATA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|