Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4566875..4567477 | Replicon | chromosome |
Accession | NZ_CP119577 | ||
Organism | Escherichia coli strain C012_chr |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | P1J04_RS22035 | Protein ID | WP_000897305.1 |
Coordinates | 4567166..4567477 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P1J04_RS22030 | Protein ID | WP_000356397.1 |
Coordinates | 4566875..4567165 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J04_RS22005 (4562801) | 4562801..4563703 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
P1J04_RS22010 (4563700) | 4563700..4564335 | + | 636 | WP_112039834.1 | formate dehydrogenase cytochrome b556 subunit | - |
P1J04_RS22015 (4564332) | 4564332..4565261 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
P1J04_RS22020 (4565591) | 4565591..4565833 | - | 243 | WP_001086388.1 | protein YiiF | - |
P1J04_RS22025 (4566052) | 4566052..4566270 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
P1J04_RS22030 (4566875) | 4566875..4567165 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
P1J04_RS22035 (4567166) | 4567166..4567477 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
P1J04_RS22040 (4567706) | 4567706..4568614 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
P1J04_RS22045 (4568678) | 4568678..4569619 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
P1J04_RS22050 (4569664) | 4569664..4570101 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
P1J04_RS22055 (4570098) | 4570098..4570970 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
P1J04_RS22060 (4570964) | 4570964..4571563 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
P1J04_RS22065 (4571662) | 4571662..4572447 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T274242 WP_000897305.1 NZ_CP119577:c4567477-4567166 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|