Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 607211..608010 | Replicon | chromosome |
Accession | NZ_CP119577 | ||
Organism | Escherichia coli strain C012_chr |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | P1J04_RS02990 | Protein ID | WP_000347266.1 |
Coordinates | 607211..607675 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | P1J04_RS02995 | Protein ID | WP_001307405.1 |
Coordinates | 607675..608010 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J04_RS02960 (602212) | 602212..602646 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P1J04_RS02965 (602664) | 602664..603542 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P1J04_RS02970 (603532) | 603532..604311 | - | 780 | WP_112039668.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P1J04_RS02975 (604322) | 604322..604795 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P1J04_RS02980 (604818) | 604818..606098 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P1J04_RS02985 (606347) | 606347..607156 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
P1J04_RS02990 (607211) | 607211..607675 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P1J04_RS02995 (607675) | 607675..608010 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P1J04_RS03000 (608159) | 608159..609730 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
P1J04_RS03005 (610105) | 610105..611439 | + | 1335 | WP_112039669.1 | galactarate/glucarate/glycerate transporter GarP | - |
P1J04_RS03010 (611455) | 611455..612225 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 607211..619945 | 12734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T274225 WP_000347266.1 NZ_CP119577:c607675-607211 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |