Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1738783..1738967 | Replicon | chromosome |
| Accession | NZ_CP119571 | ||
| Organism | Staphylococcus aureus strain N08CSA36 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | PZ486_RS08975 | Protein ID | WP_000482647.1 |
| Coordinates | 1738860..1738967 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1738783..1738843 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ486_RS08960 (PZ486_08960) | 1734313..1734480 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| PZ486_RS08965 (PZ486_08965) | 1734711..1736444 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| PZ486_RS08970 (PZ486_08970) | 1736469..1738232 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
| - | 1738783..1738843 | + | 61 | - | - | Antitoxin |
| PZ486_RS08975 (PZ486_08975) | 1738860..1738967 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PZ486_RS08980 (PZ486_08980) | 1739101..1739487 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| PZ486_RS08985 (PZ486_08985) | 1739745..1740887 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| PZ486_RS08990 (PZ486_08990) | 1740947..1741606 | + | 660 | WP_000831298.1 | membrane protein | - |
| PZ486_RS08995 (PZ486_08995) | 1741788..1742999 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| PZ486_RS09000 (PZ486_09000) | 1743122..1743595 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T274217 WP_000482647.1 NZ_CP119571:c1738967-1738860 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT274217 NZ_CP119571:1738783-1738843 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|