Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 1455171..1455368 | Replicon | chromosome |
| Accession | NZ_CP119571 | ||
| Organism | Staphylococcus aureus strain N08CSA36 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | PZ486_RS07485 | Protein ID | WP_001802298.1 |
| Coordinates | 1455264..1455368 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1455171..1455209 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ486_RS07460 (PZ486_07460) | 1451346..1452011 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| PZ486_RS07465 (PZ486_07465) | 1452163..1452483 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PZ486_RS07470 (PZ486_07470) | 1452485..1453465 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| PZ486_RS07475 (PZ486_07475) | 1453731..1454822 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| PZ486_RS07480 (PZ486_07480) | 1455151..1455225 | + | 75 | Protein_1446 | hypothetical protein | - |
| - | 1455171..1455209 | + | 39 | - | - | Antitoxin |
| PZ486_RS07485 (PZ486_07485) | 1455264..1455368 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| PZ486_RS07490 (PZ486_07490) | 1456048..1456206 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| PZ486_RS07495 (PZ486_07495) | 1456864..1457721 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
| PZ486_RS07500 (PZ486_07500) | 1457789..1458571 | - | 783 | WP_031590911.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T274215 WP_001802298.1 NZ_CP119571:c1455368-1455264 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT274215 NZ_CP119571:1455171-1455209 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|