Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1228739..1229153 Replicon chromosome
Accession NZ_CP119571
Organism Staphylococcus aureus strain N08CSA36

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PZ486_RS06235 Protein ID WP_031886311.1
Coordinates 1228902..1229153 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PZ486_RS06230 Protein ID WP_000028424.1
Coordinates 1228739..1228912 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZ486_RS06185 (PZ486_06185) 1224002..1224106 + 105 WP_078098968.1 hypothetical protein -
PZ486_RS06190 (PZ486_06190) 1224208..1226655 - 2448 WP_276097504.1 virulence-associated E family protein -
PZ486_RS06195 (PZ486_06195) 1226707..1226907 - 201 WP_000265258.1 DUF1514 family protein -
PZ486_RS06200 (PZ486_06200) 1226975..1227127 - 153 WP_045179128.1 transcriptional activator RinB -
PZ486_RS06205 (PZ486_06205) 1227124..1227513 - 390 WP_025174390.1 hypothetical protein -
PZ486_RS06210 (PZ486_06210) 1227503..1227739 - 237 WP_000608279.1 hypothetical protein -
PZ486_RS06215 (PZ486_06215) 1227732..1228019 - 288 WP_244053037.1 DUF1381 domain-containing protein -
PZ486_RS06220 (PZ486_06220) 1228056..1228562 - 507 WP_001061834.1 dUTPase -
PZ486_RS06225 (PZ486_06225) 1228577..1228738 - 162 WP_000889680.1 hypothetical protein -
PZ486_RS06230 (PZ486_06230) 1228739..1228912 - 174 WP_000028424.1 hypothetical protein Antitoxin
PZ486_RS06235 (PZ486_06235) 1228902..1229153 - 252 WP_031886311.1 DUF1024 family protein Toxin
PZ486_RS06240 (PZ486_06240) 1229146..1229454 - 309 WP_276097435.1 hypothetical protein -
PZ486_RS06245 (PZ486_06245) 1229451..1229798 - 348 WP_000979209.1 YopX family protein -
PZ486_RS06250 (PZ486_06250) 1229795..1230202 - 408 WP_000695770.1 hypothetical protein -
PZ486_RS06255 (PZ486_06255) 1230205..1230411 - 207 WP_021285869.1 hypothetical protein -
PZ486_RS06260 (PZ486_06260) 1230426..1230674 - 249 WP_078069534.1 SAV1978 family virulence-associated passenger protein -
PZ486_RS06265 (PZ486_06265) 1230674..1230928 - 255 WP_021285871.1 DUF3310 domain-containing protein -
PZ486_RS06270 (PZ486_06270) 1230928..1231545 - 618 WP_021285872.1 SA1788 family PVL leukocidin-associated protein -
PZ486_RS06275 (PZ486_06275) 1231546..1231731 - 186 WP_276097506.1 DUF3113 family protein -
PZ486_RS06280 (PZ486_06280) 1231731..1232138 - 408 WP_215347278.1 RusA family crossover junction endodeoxyribonuclease -
PZ486_RS06285 (PZ486_06285) 1232148..1232369 - 222 WP_001123688.1 DUF3269 family protein -
PZ486_RS06290 (PZ486_06290) 1232382..1232540 - 159 WP_000628839.1 hypothetical protein -
PZ486_RS06295 (PZ486_06295) 1232537..1233322 - 786 WP_024273306.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1194948..1243630 48682


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.28 Da        Isoelectric Point: 3.8567

>T274211 WP_031886311.1 NZ_CP119571:c1229153-1228902 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT274211 WP_000028424.1 NZ_CP119571:c1228912-1228739 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References