Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1117352..1117532 Replicon chromosome
Accession NZ_CP119571
Organism Staphylococcus aureus strain N08CSA36

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PZ486_RS05495 Protein ID WP_001801861.1
Coordinates 1117352..1117447 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1117475..1117532 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZ486_RS05470 (PZ486_05470) 1113407..1114033 + 627 WP_000669028.1 hypothetical protein -
PZ486_RS05475 (PZ486_05475) 1114120..1114803 + 684 WP_000957233.1 exotoxin beta-grasp domain-containing protein -
PZ486_RS05480 (PZ486_05480) 1114830..1115582 + 753 WP_000764922.1 staphylococcal enterotoxin type 27 -
PZ486_RS05485 (PZ486_05485) 1115714..1116340 - 627 Protein_1090 ImmA/IrrE family metallo-endopeptidase -
PZ486_RS05490 (PZ486_05490) 1116454..1116900 - 447 WP_000747805.1 DUF1433 domain-containing protein -
PZ486_RS05495 (PZ486_05495) 1117352..1117447 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1117475..1117532 - 58 - - Antitoxin
PZ486_RS05500 (PZ486_05500) 1117570..1117668 + 99 Protein_1093 hypothetical protein -
PZ486_RS05505 (PZ486_05505) 1118098..1119222 - 1125 WP_223876714.1 hypothetical protein -
PZ486_RS05510 (PZ486_05510) 1119284..1119793 - 510 WP_224684909.1 hypothetical protein -
PZ486_RS05515 (PZ486_05515) 1120053..1121225 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
PZ486_RS05520 (PZ486_05520) 1121196..1121957 - 762 WP_224684922.1 DNA adenine methylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk 1111643..1140148 28505
- flank IS/Tn - - 1120053..1121225 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T274209 WP_001801861.1 NZ_CP119571:1117352-1117447 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT274209 NZ_CP119571:c1117532-1117475 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References