Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 109702..110116 Replicon chromosome
Accession NZ_CP119571
Organism Staphylococcus aureus strain N08CSA36

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PZ486_RS00645 Protein ID WP_031886311.1
Coordinates 109702..109953 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PZ486_RS00650 Protein ID WP_000028424.1
Coordinates 109943..110116 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZ486_RS00580 (PZ486_00580) 104932..105288 + 357 WP_001132243.1 hypothetical protein -
PZ486_RS00585 (PZ486_00585) 105285..106526 + 1242 WP_031584867.1 DnaB helicase C-terminal domain-containing protein -
PZ486_RS00590 (PZ486_00590) 106523..106738 + 216 WP_031584864.1 hypothetical protein -
PZ486_RS00595 (PZ486_00595) 106741..106962 + 222 WP_001123688.1 DUF3269 family protein -
PZ486_RS00600 (PZ486_00600) 106972..107379 + 408 WP_029549553.1 RusA family crossover junction endodeoxyribonuclease -
PZ486_RS00605 (PZ486_00605) 107379..107564 + 186 WP_017804689.1 DUF3113 family protein -
PZ486_RS00610 (PZ486_00610) 107565..107927 + 363 WP_000536051.1 SA1788 family PVL leukocidin-associated protein -
PZ486_RS00615 (PZ486_00615) 107927..108181 + 255 WP_031584845.1 DUF3310 domain-containing protein -
PZ486_RS00620 (PZ486_00620) 108181..108429 + 249 WP_078069534.1 SAV1978 family virulence-associated passenger protein -
PZ486_RS00625 (PZ486_00625) 108444..108650 + 207 WP_021285869.1 hypothetical protein -
PZ486_RS00630 (PZ486_00630) 108653..109060 + 408 WP_000695770.1 hypothetical protein -
PZ486_RS00635 (PZ486_00635) 109057..109404 + 348 WP_000979209.1 YopX family protein -
PZ486_RS00640 (PZ486_00640) 109401..109709 + 309 WP_276097435.1 hypothetical protein -
PZ486_RS00645 (PZ486_00645) 109702..109953 + 252 WP_031886311.1 DUF1024 family protein Toxin
PZ486_RS00650 (PZ486_00650) 109943..110116 + 174 WP_000028424.1 hypothetical protein Antitoxin
PZ486_RS00655 (PZ486_00655) 110117..110278 + 162 WP_000889680.1 hypothetical protein -
PZ486_RS00660 (PZ486_00660) 110293..110799 + 507 WP_001061834.1 dUTPase -
PZ486_RS00665 (PZ486_00665) 110836..111123 + 288 WP_244053037.1 DUF1381 domain-containing protein -
PZ486_RS00670 (PZ486_00670) 111116..111352 + 237 WP_000608279.1 hypothetical protein -
PZ486_RS00675 (PZ486_00675) 111342..111731 + 390 WP_025174390.1 hypothetical protein -
PZ486_RS00680 (PZ486_00680) 111728..111880 + 153 WP_031924286.1 transcriptional regulator -
PZ486_RS00685 (PZ486_00685) 111948..112148 + 201 WP_000265252.1 DUF1514 family protein -
PZ486_RS00690 (PZ486_00690) 112436..112717 + 282 Protein_136 hypothetical protein -
PZ486_RS00695 (PZ486_00695) 112710..113573 + 864 Protein_137 ATP-dependent helicase -
PZ486_RS00700 (PZ486_00700) 113586..114023 + 438 WP_000528512.1 transcriptional regulator -
PZ486_RS00705 (PZ486_00705) 114180..114494 + 315 WP_000160693.1 HNH endonuclease -
PZ486_RS00710 (PZ486_00710) 114622..114927 + 306 WP_000778932.1 P27 family phage terminase small subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 94198..142127 47929


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.28 Da        Isoelectric Point: 3.8567

>T274208 WP_031886311.1 NZ_CP119571:109702-109953 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT274208 WP_000028424.1 NZ_CP119571:109943-110116 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References