Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3664508..3665105 | Replicon | chromosome |
Accession | NZ_CP119566 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | PYR65_RS17985 | Protein ID | WP_276118964.1 |
Coordinates | 3664824..3665105 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PYR65_RS17980 | Protein ID | WP_276118963.1 |
Coordinates | 3664508..3664807 (-) | Length | 100 a.a. |
Genomic Context
Location: 3660401..3660928 (528 bp)
Type: Others
Protein ID: WP_276118960.1
Type: Others
Protein ID: WP_276118960.1
Location: 3669314..3669511 (198 bp)
Type: Others
Protein ID: WP_276118968.1
Type: Others
Protein ID: WP_276118968.1
Location: 3661149..3661637 (489 bp)
Type: Others
Protein ID: WP_276118961.1
Type: Others
Protein ID: WP_276118961.1
Location: 3661700..3662014 (315 bp)
Type: Others
Protein ID: WP_060636467.1
Type: Others
Protein ID: WP_060636467.1
Location: 3662059..3664413 (2355 bp)
Type: Others
Protein ID: WP_276118962.1
Type: Others
Protein ID: WP_276118962.1
Location: 3664508..3664807 (300 bp)
Type: Antitoxin
Protein ID: WP_276118963.1
Type: Antitoxin
Protein ID: WP_276118963.1
Location: 3664824..3665105 (282 bp)
Type: Toxin
Protein ID: WP_276118964.1
Type: Toxin
Protein ID: WP_276118964.1
Location: 3665201..3667144 (1944 bp)
Type: Others
Protein ID: WP_276118965.1
Type: Others
Protein ID: WP_276118965.1
Location: 3667190..3668458 (1269 bp)
Type: Others
Protein ID: WP_276118966.1
Type: Others
Protein ID: WP_276118966.1
Location: 3668559..3669107 (549 bp)
Type: Others
Protein ID: WP_276118967.1
Type: Others
Protein ID: WP_276118967.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS17960 | 3660401..3660928 | + | 528 | WP_276118960.1 | plant virulence effector HPE1-like domain-containing protein | - |
PYR65_RS17965 | 3661149..3661637 | - | 489 | WP_276118961.1 | DUF523 domain-containing protein | - |
PYR65_RS17970 | 3661700..3662014 | - | 315 | WP_060636467.1 | hypothetical protein | - |
PYR65_RS17975 | 3662059..3664413 | - | 2355 | WP_276118962.1 | glycine--tRNA ligase subunit beta | - |
PYR65_RS17980 | 3664508..3664807 | - | 300 | WP_276118963.1 | HigA family addiction module antitoxin | Antitoxin |
PYR65_RS17985 | 3664824..3665105 | - | 282 | WP_276118964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYR65_RS17990 | 3665201..3667144 | - | 1944 | WP_276118965.1 | DUF2207 domain-containing protein | - |
PYR65_RS17995 | 3667190..3668458 | - | 1269 | WP_276118966.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
PYR65_RS18000 | 3668559..3669107 | - | 549 | WP_276118967.1 | LemA family protein | - |
PYR65_RS18005 | 3669314..3669511 | + | 198 | WP_276118968.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10403.89 Da Isoelectric Point: 9.1862
>T274202 WP_276118964.1 NZ_CP119566:c3665105-3664824 [Pararhizobium sp. T808]
VIRSFKGKISAALADGSMKKGFPTDLVRRAQQLLVLLNAACDVKDLRSPPGNRLEKLSGDREGQYSIRINQQWRICFVWS
NGGADDVEIVDYH
VIRSFKGKISAALADGSMKKGFPTDLVRRAQQLLVLLNAACDVKDLRSPPGNRLEKLSGDREGQYSIRINQQWRICFVWS
NGGADDVEIVDYH
Download Length: 282 bp