Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 3165430..3166007 | Replicon | chromosome |
Accession | NZ_CP119566 | ||
Organism | Pararhizobium sp. T808 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PYR65_RS15435 | Protein ID | WP_276118596.1 |
Coordinates | 3165729..3166007 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0Q7M364 |
Locus tag | PYR65_RS15430 | Protein ID | WP_060641242.1 |
Coordinates | 3165430..3165717 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR65_RS15405 | 3161161..3162006 | - | 846 | WP_276118592.1 | oxidoreductase | - |
PYR65_RS15410 | 3162091..3162435 | - | 345 | WP_276118593.1 | cupin domain-containing protein | - |
PYR65_RS15415 | 3162490..3163770 | - | 1281 | WP_060641239.1 | O-acetylhomoserine aminocarboxypropyltransferase | - |
PYR65_RS15420 | 3163902..3164330 | - | 429 | WP_276118594.1 | CoA-binding protein | - |
PYR65_RS15425 | 3164574..3165410 | + | 837 | WP_276118595.1 | EamA family transporter | - |
PYR65_RS15430 | 3165430..3165717 | - | 288 | WP_060641242.1 | HigA family addiction module antitoxin | Antitoxin |
PYR65_RS15435 | 3165729..3166007 | - | 279 | WP_276118596.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYR65_RS15440 | 3166060..3166881 | - | 822 | WP_276118597.1 | enoyl-CoA hydratase | - |
PYR65_RS15445 | 3167038..3167469 | + | 432 | WP_276118598.1 | PaaI family thioesterase | - |
PYR65_RS15450 | 3167696..3168160 | + | 465 | WP_060641245.1 | 50S ribosomal protein L13 | - |
PYR65_RS15455 | 3168163..3168636 | + | 474 | WP_060641246.1 | 30S ribosomal protein S9 | - |
PYR65_RS15460 | 3168715..3169176 | - | 462 | WP_060641247.1 | Lrp/AsnC family transcriptional regulator | - |
PYR65_RS15465 | 3169299..3170090 | + | 792 | WP_276118599.1 | phenylalanine 4-monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10384.92 Da Isoelectric Point: 10.0104
>T274197 WP_276118596.1 NZ_CP119566:c3166007-3165729 [Pararhizobium sp. T808]
MIKSIANTATRQFTESGKSKFSGLDAGKAKMRLVMLQNARSLDDLAPLKSVGLHKLSGDRKNQWAMTINGPWRLCFRFED
GHAYDVEIVDYH
MIKSIANTATRQFTESGKSKFSGLDAGKAKMRLVMLQNARSLDDLAPLKSVGLHKLSGDRKNQWAMTINGPWRLCFRFED
GHAYDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|