Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1758887..1759471 | Replicon | chromosome |
| Accession | NZ_CP119563 | ||
| Organism | Rhodobacter capsulatus strain 37b4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1G7QST7 |
| Locus tag | PUH89_RS08530 | Protein ID | WP_074555902.1 |
| Coordinates | 1759190..1759471 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | A0A1G7QST0 |
| Locus tag | PUH89_RS08525 | Protein ID | WP_074555901.1 |
| Coordinates | 1758887..1759177 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUH89_RS08505 (PUH89_08505) | 1754803..1756401 | + | 1599 | WP_074555897.1 | hypothetical protein | - |
| PUH89_RS08510 (PUH89_08510) | 1756435..1756677 | + | 243 | WP_074555898.1 | hypothetical protein | - |
| PUH89_RS08515 (PUH89_08515) | 1756751..1757044 | + | 294 | WP_074555899.1 | hypothetical protein | - |
| PUH89_RS08520 (PUH89_08520) | 1757461..1758552 | + | 1092 | WP_074555900.1 | hypothetical protein | - |
| PUH89_RS08525 (PUH89_08525) | 1758887..1759177 | - | 291 | WP_074555901.1 | HigA family addiction module antitoxin | Antitoxin |
| PUH89_RS08530 (PUH89_08530) | 1759190..1759471 | - | 282 | WP_074555902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUH89_RS08535 (PUH89_08535) | 1759929..1761035 | + | 1107 | WP_201778588.1 | DNA adenine methylase | - |
| PUH89_RS08540 (PUH89_08540) | 1761035..1761871 | + | 837 | WP_055211498.1 | DpnII family type II restriction endonuclease | - |
| PUH89_RS08545 (PUH89_08545) | 1761968..1762763 | - | 796 | Protein_1684 | DNA adenine methylase | - |
| PUH89_RS08550 (PUH89_08550) | 1762941..1763288 | - | 348 | WP_276131108.1 | hypothetical protein | - |
| PUH89_RS08555 (PUH89_08555) | 1763436..1764026 | + | 591 | WP_276131099.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1753603..1763288 | 9685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10434.80 Da Isoelectric Point: 7.2773
>T274191 WP_074555902.1 NZ_CP119563:c1759471-1759190 [Rhodobacter capsulatus]
MIQSTKGKLATDAVNGHYGKDFPSDLVKRTRVLLSALHAASVLEDLRFPPGNNLEELKGDRAGQHSVRINRQWRICFVWT
ETGPADIEIADYQ
MIQSTKGKLATDAVNGHYGKDFPSDLVKRTRVLLSALHAASVLEDLRFPPGNNLEELKGDRAGQHSVRINRQWRICFVWT
ETGPADIEIADYQ
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1G7QST7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1G7QST0 |