Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 3067917..3068315 | Replicon | chromosome |
| Accession | NZ_CP119528 | ||
| Organism | Enterococcus faecalis strain 3143 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | P0083_RS15320 | Protein ID | WP_021164545.1 |
| Coordinates | 3068211..3068315 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 3067917..3068071 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0083_RS15305 | 3063595..3064227 | - | 633 | WP_002358972.1 | RloB family protein | - |
| P0083_RS15310 | 3064236..3065531 | - | 1296 | WP_002379013.1 | ATP-binding protein | - |
| P0083_RS15315 | 3065993..3067609 | + | 1617 | WP_002379014.1 | phosphatase PAP2/LCP family protein | - |
| - | 3067917..3068071 | - | 155 | - | - | Antitoxin |
| P0083_RS15320 | 3068211..3068315 | + | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
| P0083_RS15325 | 3068505..3072263 | - | 3759 | WP_010706868.1 | WxL domain-containing protein | - |
| P0083_RS15330 | 3072859..3073002 | + | 144 | WP_002387585.1 | putative holin-like toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T274153 WP_021164545.1 NZ_CP119528:3068211-3068315 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
Antitoxin
Download Length: 155 bp
>AT274153 NZ_CP119528:c3068071-3067917 [Enterococcus faecalis]
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|