Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 400565..400759 | Replicon | chromosome |
Accession | NZ_CP119528 | ||
Organism | Enterococcus faecalis strain 3143 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | P0083_RS02195 | Protein ID | WP_015543884.1 |
Coordinates | 400664..400759 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 400565..400629 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0083_RS02180 | 396198..397940 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
P0083_RS02185 | 397931..399964 | + | 2034 | WP_002387671.1 | PRD domain-containing protein | - |
P0083_RS02190 | 399975..400409 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 400565..400629 | + | 65 | - | - | Antitoxin |
P0083_RS02195 | 400664..400759 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
P0083_RS02200 | 401005..402777 | + | 1773 | WP_010706745.1 | PTS mannitol-specific transporter subunit IIBC | - |
P0083_RS02205 | 402792..403229 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
P0083_RS02210 | 403244..404398 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
P0083_RS02215 | 404465..405580 | - | 1116 | WP_002379062.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T274142 WP_015543884.1 NZ_CP119528:c400759-400664 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT274142 NZ_CP119528:400565-400629 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|