Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324447..325033 Replicon chromosome
Accession NZ_CP119408
Organism Klebsiella pneumoniae strain NW202109

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P0M34_RS01510 Protein ID WP_002920800.1
Coordinates 324665..325033 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P0M34_RS01505 Protein ID WP_004174006.1
Coordinates 324447..324668 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0M34_RS01485 (320604) 320604..321530 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P0M34_RS01490 (321527) 321527..322804 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P0M34_RS01495 (322801) 322801..323568 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P0M34_RS01500 (323570) 323570..324283 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P0M34_RS01505 (324447) 324447..324668 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P0M34_RS01510 (324665) 324665..325033 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P0M34_RS01515 (325306) 325306..326622 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P0M34_RS01520 (326729) 326729..327616 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P0M34_RS01525 (327613) 327613..328458 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P0M34_RS01530 (328460) 328460..329530 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321527..330267 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T274114 WP_002920800.1 NZ_CP119408:324665-325033 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT274114 WP_004174006.1 NZ_CP119408:324447-324668 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References