Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3677131..3677825 Replicon chromosome
Accession NZ_CP119404
Organism Escherichia coli strain MRE162 substr. UK

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag PX811_RS17945 Protein ID WP_001263493.1
Coordinates 3677131..3677529 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag PX811_RS17950 Protein ID WP_000554757.1
Coordinates 3677532..3677825 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3672791) 3672791..3672871 - 81 NuclAT_11 - -
- (3672791) 3672791..3672871 - 81 NuclAT_11 - -
- (3672791) 3672791..3672871 - 81 NuclAT_11 - -
- (3672791) 3672791..3672871 - 81 NuclAT_11 - -
PX811_RS17915 (3672131) 3672131..3673375 - 1245 WP_000189541.1 esterase FrsA -
PX811_RS17920 (3673467) 3673467..3673925 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PX811_RS17925 (3674186) 3674186..3675643 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
PX811_RS17930 (3675700) 3675700..3676221 - 522 Protein_3506 peptide chain release factor H -
PX811_RS17935 (3676220) 3676220..3676423 - 204 Protein_3507 RtcB family protein -
PX811_RS17940 (3676669) 3676669..3677121 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
PX811_RS17945 (3677131) 3677131..3677529 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PX811_RS17950 (3677532) 3677532..3677825 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PX811_RS17955 (3677877) 3677877..3678932 - 1056 WP_001226164.1 DNA polymerase IV -
PX811_RS17960 (3679003) 3679003..3679788 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
PX811_RS17965 (3679760) 3679760..3681472 + 1713 Protein_3513 flagellar biosynthesis protein FlhA -
PX811_RS17970 (3681696) 3681696..3682193 - 498 WP_275771098.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T274108 WP_001263493.1 NZ_CP119404:c3677529-3677131 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT274108 WP_000554757.1 NZ_CP119404:c3677825-3677532 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References