Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3671801..3672495 Replicon chromosome
Accession NZ_CP119402
Organism Escherichia coli strain MRE162 substr. FRA

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag PX810_RS17915 Protein ID WP_001263493.1
Coordinates 3671801..3672199 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag PX810_RS17920 Protein ID WP_000554757.1
Coordinates 3672202..3672495 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3667461) 3667461..3667541 - 81 NuclAT_11 - -
- (3667461) 3667461..3667541 - 81 NuclAT_11 - -
- (3667461) 3667461..3667541 - 81 NuclAT_11 - -
- (3667461) 3667461..3667541 - 81 NuclAT_11 - -
PX810_RS17885 (3666801) 3666801..3668045 - 1245 WP_000189541.1 esterase FrsA -
PX810_RS17890 (3668137) 3668137..3668595 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PX810_RS17895 (3668856) 3668856..3670313 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
PX810_RS17900 (3670370) 3670370..3670891 - 522 Protein_3500 peptide chain release factor H -
PX810_RS17905 (3670890) 3670890..3671093 - 204 Protein_3501 RtcB family protein -
PX810_RS17910 (3671339) 3671339..3671791 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
PX810_RS17915 (3671801) 3671801..3672199 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PX810_RS17920 (3672202) 3672202..3672495 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PX810_RS17925 (3672547) 3672547..3673602 - 1056 WP_001226164.1 DNA polymerase IV -
PX810_RS17930 (3673673) 3673673..3674458 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
PX810_RS17935 (3674430) 3674430..3676142 + 1713 Protein_3507 flagellar biosynthesis protein FlhA -
PX810_RS17940 (3676366) 3676366..3676863 - 498 WP_275771098.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T274089 WP_001263493.1 NZ_CP119402:c3672199-3671801 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT274089 WP_000554757.1 NZ_CP119402:c3672495-3672202 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References