Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3676696..3677390 Replicon chromosome
Accession NZ_CP119400
Organism Escherichia coli strain MRE162 substr. NOR

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag PX809_RS17920 Protein ID WP_001263493.1
Coordinates 3676696..3677094 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag PX809_RS17925 Protein ID WP_000554757.1
Coordinates 3677097..3677390 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3672356) 3672356..3672436 - 81 NuclAT_11 - -
- (3672356) 3672356..3672436 - 81 NuclAT_11 - -
- (3672356) 3672356..3672436 - 81 NuclAT_11 - -
- (3672356) 3672356..3672436 - 81 NuclAT_11 - -
PX809_RS17890 (3671696) 3671696..3672940 - 1245 WP_000189541.1 esterase FrsA -
PX809_RS17895 (3673032) 3673032..3673490 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PX809_RS17900 (3673751) 3673751..3675208 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
PX809_RS17905 (3675265) 3675265..3675786 - 522 Protein_3501 peptide chain release factor H -
PX809_RS17910 (3675785) 3675785..3675988 - 204 Protein_3502 RtcB family protein -
PX809_RS17915 (3676234) 3676234..3676686 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
PX809_RS17920 (3676696) 3676696..3677094 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PX809_RS17925 (3677097) 3677097..3677390 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PX809_RS17930 (3677442) 3677442..3678497 - 1056 WP_001226164.1 DNA polymerase IV -
PX809_RS17935 (3678568) 3678568..3679353 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
PX809_RS17940 (3679325) 3679325..3681037 + 1713 Protein_3508 flagellar biosynthesis protein FlhA -
PX809_RS17945 (3681261) 3681261..3681758 - 498 WP_275771098.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T274070 WP_001263493.1 NZ_CP119400:c3677094-3676696 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT274070 WP_000554757.1 NZ_CP119400:c3677390-3677097 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References