Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2203291..2203488 | Replicon | chromosome |
| Accession | NZ_CP119344 | ||
| Organism | Staphylococcus aureus strain N29CSA11 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | P1A16_RS10905 | Protein ID | WP_001802298.1 |
| Coordinates | 2203384..2203488 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2203291..2203329 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A16_RS10880 (P1A16_10880) | 2199466..2200131 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| P1A16_RS10885 (P1A16_10885) | 2200283..2200603 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| P1A16_RS10890 (P1A16_10890) | 2200605..2201585 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| P1A16_RS10895 (P1A16_10895) | 2201851..2202942 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| P1A16_RS10900 (P1A16_10900) | 2203271..2203345 | + | 75 | Protein_2107 | hypothetical protein | - |
| - | 2203291..2203329 | + | 39 | - | - | Antitoxin |
| P1A16_RS10905 (P1A16_10905) | 2203384..2203488 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| P1A16_RS10910 (P1A16_10910) | 2204168..2204326 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| P1A16_RS10915 (P1A16_10915) | 2204984..2205841 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
| P1A16_RS10920 (P1A16_10920) | 2205909..2206691 | - | 783 | WP_031590911.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T274018 WP_001802298.1 NZ_CP119344:c2203488-2203384 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT274018 NZ_CP119344:2203291-2203329 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|