Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1924397..1924577 Replicon chromosome
Accession NZ_CP119344
Organism Staphylococcus aureus strain N29CSA11

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag P1A16_RS09330 Protein ID WP_001801861.1
Coordinates 1924397..1924492 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1924520..1924577 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A16_RS09300 (P1A16_09300) 1920452..1921078 + 627 WP_000669028.1 hypothetical protein -
P1A16_RS09305 (P1A16_09305) 1921165..1921848 + 684 WP_000957233.1 exotoxin beta-grasp domain-containing protein -
P1A16_RS09310 (P1A16_09310) 1921875..1922627 + 753 WP_000764922.1 staphylococcal enterotoxin type 27 -
P1A16_RS09315 (P1A16_09315) 1922759..1923385 - 627 Protein_1833 ImmA/IrrE family metallo-endopeptidase -
P1A16_RS09320 (P1A16_09320) 1923499..1923945 - 447 WP_000747805.1 DUF1433 domain-containing protein -
P1A16_RS09325 (P1A16_09325) 1924121..1924252 - 132 WP_001808010.1 hypothetical protein -
P1A16_RS09330 (P1A16_09330) 1924397..1924492 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1924520..1924577 - 58 - - Antitoxin
P1A16_RS09335 (P1A16_09335) 1924615..1924713 + 99 Protein_1837 hypothetical protein -
P1A16_RS09340 (P1A16_09340) 1925143..1926228 - 1086 WP_001808016.1 hypothetical protein -
P1A16_RS09345 (P1A16_09345) 1926328..1926837 - 510 WP_224684909.1 hypothetical protein -
P1A16_RS09350 (P1A16_09350) 1927097..1928269 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
P1A16_RS09355 (P1A16_09355) 1928240..1929058 - 819 WP_260644747.1 exotoxin OB-fold domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1927097..1928269 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T274014 WP_001801861.1 NZ_CP119344:1924397-1924492 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT274014 NZ_CP119344:c1924577-1924520 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References