Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2260363..2260560 | Replicon | chromosome |
| Accession | NZ_CP119341 | ||
| Organism | Staphylococcus aureus strain N29CSA02 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | P1A17_RS11310 | Protein ID | WP_001802298.1 |
| Coordinates | 2260456..2260560 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2260363..2260401 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A17_RS11285 | 2256538..2257203 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| P1A17_RS11290 | 2257355..2257675 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| P1A17_RS11295 | 2257677..2258657 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| P1A17_RS11300 | 2258923..2260014 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| P1A17_RS11305 | 2260343..2260417 | + | 75 | Protein_2188 | hypothetical protein | - |
| - | 2260363..2260401 | + | 39 | - | - | Antitoxin |
| P1A17_RS11310 | 2260456..2260560 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| P1A17_RS11315 | 2261240..2261398 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| P1A17_RS11320 | 2262056..2262913 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
| P1A17_RS11325 | 2262981..2263763 | - | 783 | WP_031590911.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T274009 WP_001802298.1 NZ_CP119341:c2260560-2260456 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT274009 NZ_CP119341:2260363-2260401 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|