Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | holin-SprF1/- |
| Location | 2078824..2079299 | Replicon | chromosome |
| Accession | NZ_CP119341 | ||
| Organism | Staphylococcus aureus strain N29CSA02 | ||
Toxin (Protein)
| Gene name | holin | Uniprot ID | - |
| Locus tag | P1A17_RS10280 | Protein ID | WP_000387655.1 |
| Coordinates | 2078824..2079126 (-) | Length | 101 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2079175..2079299 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A17_RS10260 | 2074644..2075597 | - | 954 | WP_000766912.1 | ornithine cyclodeaminase family protein | - |
| P1A17_RS10265 | 2076095..2076196 | - | 102 | Protein_1985 | hypothetical protein | - |
| P1A17_RS10270 | 2076274..2077014 | - | 741 | WP_000185611.1 | type II CAAX endopeptidase family protein | - |
| P1A17_RS10275 | 2077359..2078813 | - | 1455 | WP_000930251.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P1A17_RS10280 | 2078824..2079126 | - | 303 | WP_000387655.1 | phage holin | Toxin |
| - | 2079175..2079299 | + | 125 | - | - | Antitoxin |
| P1A17_RS10290 | 2079324..2079431 | - | 108 | WP_000253687.1 | putative holin-like toxin | - |
| P1A17_RS10295 | 2079665..2079964 | - | 300 | WP_000466781.1 | DUF2951 family protein | - |
| P1A17_RS10300 | 2080010..2080174 | - | 165 | WP_000916020.1 | XkdX family protein | - |
| P1A17_RS10305 | 2080167..2080556 | - | 390 | WP_001166602.1 | DUF2977 domain-containing protein | - |
| P1A17_RS10310 | 2080556..2082022 | - | 1467 | WP_000067150.1 | BppU family phage baseplate upper protein | - |
| P1A17_RS10315 | 2082052..2083932 | - | 1881 | WP_275600309.1 | hypothetical protein | - |
| P1A17_RS10320 | 2083948..2084238 | - | 291 | WP_000179860.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlb / groEL | 2077359..2134708 | 57349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11127.85 Da Isoelectric Point: 9.6587
>T274001 WP_000387655.1 NZ_CP119341:c2079126-2078824 [Staphylococcus aureus]
MEAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVIALYTTYKDNPTSQEGRWANQKLKKYKAESKYRKATG
QAPVKEVIAPTNMNDTNDLG
MEAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVIALYTTYKDNPTSQEGRWANQKLKKYKAESKYRKATG
QAPVKEVIAPTNMNDTNDLG
Download Length: 303 bp
Antitoxin
Download Length: 125 bp
>AT274001 NZ_CP119341:2079175-2079299 [Staphylococcus aureus]
ATTTGATATTTATATTATGATGTGTTAATTTATATATAGAAAAAGGGCAACATGCGGAAACATGTCACCCTAGTGAGCCC
GTTAAAAAGACGGTGACCTCTTTTATATGATTAATAAATAACCAT
ATTTGATATTTATATTATGATGTGTTAATTTATATATAGAAAAAGGGCAACATGCGGAAACATGTCACCCTAGTGAGCCC
GTTAAAAAGACGGTGACCTCTTTTATATGATTAATAAATAACCAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|