Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1920247..1920427 | Replicon | chromosome |
Accession | NZ_CP119341 | ||
Organism | Staphylococcus aureus strain N29CSA02 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | P1A17_RS09315 | Protein ID | WP_001801861.1 |
Coordinates | 1920247..1920342 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1920370..1920427 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1A17_RS09290 | 1916302..1916928 | + | 627 | WP_000669028.1 | hypothetical protein | - |
P1A17_RS09295 | 1917015..1917698 | + | 684 | WP_000957233.1 | exotoxin beta-grasp domain-containing protein | - |
P1A17_RS09300 | 1917725..1918477 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
P1A17_RS09305 | 1918609..1919235 | - | 627 | Protein_1831 | ImmA/IrrE family metallo-endopeptidase | - |
P1A17_RS09310 | 1919349..1919795 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
P1A17_RS09315 | 1920247..1920342 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1920370..1920427 | - | 58 | - | - | Antitoxin |
P1A17_RS09320 | 1920465..1920563 | + | 99 | Protein_1834 | hypothetical protein | - |
P1A17_RS09325 | 1920993..1922117 | - | 1125 | WP_223876714.1 | hypothetical protein | - |
P1A17_RS09330 | 1922179..1922688 | - | 510 | WP_224684909.1 | hypothetical protein | - |
P1A17_RS09335 | 1922948..1924120 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
P1A17_RS09340 | 1924091..1924852 | - | 762 | WP_224684922.1 | DNA adenine methylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1913743..1944375 | 30632 | |
- | flank | IS/Tn | - | - | 1922948..1924120 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T273999 WP_001801861.1 NZ_CP119341:1920247-1920342 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT273999 NZ_CP119341:c1920427-1920370 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|