Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2515479..2515663 | Replicon | chromosome |
| Accession | NZ_CP119340 | ||
| Organism | Staphylococcus aureus strain N28CSA05 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | P1A15_RS12545 | Protein ID | WP_000482647.1 |
| Coordinates | 2515556..2515663 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2515479..2515539 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A15_RS12530 (P1A15_12530) | 2511009..2511176 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| P1A15_RS12535 (P1A15_12535) | 2511407..2513140 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| P1A15_RS12540 (P1A15_12540) | 2513165..2514928 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
| - | 2515479..2515539 | + | 61 | - | - | Antitoxin |
| P1A15_RS12545 (P1A15_12545) | 2515556..2515663 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| P1A15_RS12550 (P1A15_12550) | 2515797..2516183 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| P1A15_RS12555 (P1A15_12555) | 2516441..2517583 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| P1A15_RS12560 (P1A15_12560) | 2517643..2518302 | + | 660 | WP_000831298.1 | membrane protein | - |
| P1A15_RS12565 (P1A15_12565) | 2518484..2519695 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| P1A15_RS12570 (P1A15_12570) | 2519818..2520291 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T273996 WP_000482647.1 NZ_CP119340:c2515663-2515556 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT273996 NZ_CP119340:2515479-2515539 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|