Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2232021..2232218 | Replicon | chromosome |
Accession | NZ_CP119340 | ||
Organism | Staphylococcus aureus strain N28CSA05 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | P1A15_RS11055 | Protein ID | WP_001802298.1 |
Coordinates | 2232114..2232218 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2232021..2232059 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1A15_RS11030 (P1A15_11030) | 2228196..2228861 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
P1A15_RS11035 (P1A15_11035) | 2229013..2229333 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
P1A15_RS11040 (P1A15_11040) | 2229335..2230315 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
P1A15_RS11045 (P1A15_11045) | 2230581..2231672 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
P1A15_RS11050 (P1A15_11050) | 2232001..2232075 | + | 75 | Protein_2137 | hypothetical protein | - |
- | 2232021..2232059 | + | 39 | - | - | Antitoxin |
P1A15_RS11055 (P1A15_11055) | 2232114..2232218 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
P1A15_RS11060 (P1A15_11060) | 2232898..2233056 | + | 159 | WP_001792784.1 | hypothetical protein | - |
P1A15_RS11065 (P1A15_11065) | 2233714..2234571 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
P1A15_RS11070 (P1A15_11070) | 2234639..2235421 | - | 783 | WP_031590911.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T273994 WP_001802298.1 NZ_CP119340:c2232218-2232114 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT273994 NZ_CP119340:2232021-2232059 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|