Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1941458..1941638 | Replicon | chromosome |
| Accession | NZ_CP119340 | ||
| Organism | Staphylococcus aureus strain N28CSA05 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | P1A15_RS09420 | Protein ID | WP_001801861.1 |
| Coordinates | 1941458..1941553 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1941581..1941638 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A15_RS09390 (P1A15_09390) | 1937513..1938139 | + | 627 | WP_000669028.1 | hypothetical protein | - |
| P1A15_RS09395 (P1A15_09395) | 1938226..1938909 | + | 684 | WP_000957233.1 | exotoxin beta-grasp domain-containing protein | - |
| P1A15_RS09400 (P1A15_09400) | 1938936..1939688 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
| P1A15_RS09405 (P1A15_09405) | 1939820..1940446 | - | 627 | Protein_1851 | ImmA/IrrE family metallo-endopeptidase | - |
| P1A15_RS09410 (P1A15_09410) | 1940560..1941006 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
| P1A15_RS09415 (P1A15_09415) | 1941182..1941313 | - | 132 | WP_001808010.1 | hypothetical protein | - |
| P1A15_RS09420 (P1A15_09420) | 1941458..1941553 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1941581..1941638 | - | 58 | - | - | Antitoxin |
| P1A15_RS09425 (P1A15_09425) | 1941676..1941774 | + | 99 | Protein_1855 | hypothetical protein | - |
| P1A15_RS09430 (P1A15_09430) | 1942204..1943328 | - | 1125 | WP_223876714.1 | hypothetical protein | - |
| P1A15_RS09435 (P1A15_09435) | 1943390..1943899 | - | 510 | WP_224684909.1 | hypothetical protein | - |
| P1A15_RS09440 (P1A15_09440) | 1944159..1945331 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| P1A15_RS09445 (P1A15_09445) | 1945302..1946063 | - | 762 | WP_224684922.1 | DNA adenine methylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1934954..1964254 | 29300 | |
| - | flank | IS/Tn | - | - | 1944159..1945331 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T273990 WP_001801861.1 NZ_CP119340:1941458-1941553 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT273990 NZ_CP119340:c1941638-1941581 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
