Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2227575..2227772 | Replicon | chromosome |
Accession | NZ_CP119338 | ||
Organism | Staphylococcus aureus strain N09HSA11 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | P1A14_RS11030 | Protein ID | WP_001802298.1 |
Coordinates | 2227668..2227772 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2227575..2227613 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1A14_RS11005 (P1A14_11005) | 2223750..2224415 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
P1A14_RS11010 (P1A14_11010) | 2224567..2224887 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
P1A14_RS11015 (P1A14_11015) | 2224889..2225869 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
P1A14_RS11020 (P1A14_11020) | 2226135..2227226 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
P1A14_RS11025 (P1A14_11025) | 2227555..2227629 | + | 75 | Protein_2135 | hypothetical protein | - |
- | 2227575..2227613 | + | 39 | - | - | Antitoxin |
P1A14_RS11030 (P1A14_11030) | 2227668..2227772 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
P1A14_RS11035 (P1A14_11035) | 2228289..2228459 | + | 171 | WP_001792292.1 | transposase | - |
P1A14_RS11040 (P1A14_11040) | 2228452..2228610 | + | 159 | WP_001792784.1 | hypothetical protein | - |
P1A14_RS11045 (P1A14_11045) | 2229268..2230125 | - | 858 | WP_000370930.1 | HAD family hydrolase | - |
P1A14_RS11050 (P1A14_11050) | 2230193..2230975 | - | 783 | WP_031590911.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T273985 WP_001802298.1 NZ_CP119338:c2227772-2227668 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT273985 NZ_CP119338:2227575-2227613 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|