Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 119839..120484 | Replicon | plasmid unnamed1 |
Accession | NZ_CP119336 | ||
Organism | Vibrio alginolyticus strain 2-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PY250_RS23915 | Protein ID | WP_258520172.1 |
Coordinates | 119839..120189 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PY250_RS23920 | Protein ID | WP_170897565.1 |
Coordinates | 120179..120484 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY250_RS23870 (PY250_23870) | 114966..115373 | - | 408 | WP_004364961.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
PY250_RS23875 (PY250_23875) | 115469..116365 | + | 897 | WP_020744994.1 | cation transporter | - |
PY250_RS23880 (PY250_23880) | 116369..116473 | + | 105 | Protein_122 | signal peptidase II | - |
PY250_RS23885 (PY250_23885) | 116485..116817 | + | 333 | Protein_123 | transposase | - |
PY250_RS23890 (PY250_23890) | 116903..117430 | + | 528 | WP_275593691.1 | Spy/CpxP family protein refolding chaperone | - |
PY250_RS23895 (PY250_23895) | 117441..117722 | + | 282 | WP_105935177.1 | SHOCT domain-containing protein | - |
PY250_RS23900 (PY250_23900) | 117780..118169 | + | 390 | WP_113606151.1 | metalloregulator ArsR/SmtB family transcription factor | - |
PY250_RS23905 (PY250_23905) | 118245..118394 | + | 150 | WP_181714985.1 | hypothetical protein | - |
PY250_RS23910 (PY250_23910) | 118939..119565 | - | 627 | WP_238777244.1 | recombinase family protein | - |
PY250_RS23915 (PY250_23915) | 119839..120189 | + | 351 | WP_258520172.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PY250_RS23920 (PY250_23920) | 120179..120484 | + | 306 | WP_170897565.1 | XRE family transcriptional regulator | Antitoxin |
PY250_RS23925 (PY250_23925) | 120722..122194 | - | 1473 | WP_275593694.1 | group II intron reverse transcriptase/maturase | - |
PY250_RS23930 (PY250_23930) | 122904..123004 | + | 101 | Protein_132 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..237145 | 237145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13475.31 Da Isoelectric Point: 4.9860
>T273979 WP_258520172.1 NZ_CP119336:119839-120189 [Vibrio alginolyticus]
MWNVVTRPLFDEWFLSLDESDQINVRACIQVLLERGPQLSRPYADTVEDSKHSNMKELRVQSNGKPIRAFFAFDPERTGI
ILCGGDKTGDKRFYKKMIPIADAEFDEHLEELKNEK
MWNVVTRPLFDEWFLSLDESDQINVRACIQVLLERGPQLSRPYADTVEDSKHSNMKELRVQSNGKPIRAFFAFDPERTGI
ILCGGDKTGDKRFYKKMIPIADAEFDEHLEELKNEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|