Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 119594..120321 | Replicon | plasmid pWZ0036KPC |
| Accession | NZ_CP119333 | ||
| Organism | Klebsiella pneumoniae strain CQ22WZ0036 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OMP07_RS28420 | Protein ID | WP_011251285.1 |
| Coordinates | 119594..119905 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OMP07_RS28425 | Protein ID | WP_011251286.1 |
| Coordinates | 119902..120321 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP07_RS28395 (115113) | 115113..115607 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| OMP07_RS28400 (115785) | 115785..116051 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| OMP07_RS28405 (116084) | 116084..116734 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| OMP07_RS28415 (118952) | 118952..119389 | + | 438 | Protein_149 | DDE-type integrase/transposase/recombinase | - |
| OMP07_RS28420 (119594) | 119594..119905 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OMP07_RS28425 (119902) | 119902..120321 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OMP07_RS28430 (120468) | 120468..121436 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| OMP07_RS28435 (121508) | 121508..121873 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OMP07_RS28440 (121887) | 121887..122675 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OMP07_RS28445 (122696) | 122696..123316 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OMP07_RS28450 (123735) | 123735..124370 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| OMP07_RS28455 (124683) | 124683..125153 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..155833 | 155833 | |
| - | inside | IScluster/Tn | blaSHV-12 | - | 99735..128161 | 28426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T273976 WP_011251285.1 NZ_CP119333:119594-119905 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT273976 WP_011251286.1 NZ_CP119333:119902-120321 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|