Detailed information of TA system TA273974

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95438..95707
• Replicon: plasmid pWZ0036KPC
• Accession: NZ_CP119333
• Organism: Klebsiella pneumoniae strain CQ22WZ0036

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OMP07_RS28295
• Protein ID: WP_001372321.1
• Coordinates: 95582..95707 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	95438..95503 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OMP07_RS28265	91148..91675	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OMP07_RS28270	91733..91966	+	234	WP_000006003.1	DUF905 family protein	-
OMP07_RS28275	92027..94050	+	2024	Protein_121	ParB/RepB/Spo0J family partition protein	-
OMP07_RS28280	94119..94553	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OMP07_RS28285	94550..95269	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	95281..95505	+	225	NuclAT_0	-	-
-	95281..95505	+	225	NuclAT_0	-	-
-	95281..95505	+	225	NuclAT_0	-	-
-	95281..95505	+	225	NuclAT_0	-	-
-	95438..95503	-	66	-	-	Antitoxin
OMP07_RS28290	95491..95640	+	150	Protein_124	plasmid maintenance protein Mok	-
OMP07_RS28295	95582..95707	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OMP07_RS28300	96026..96322	-	297	Protein_126	hypothetical protein	-
OMP07_RS28305	96622..96918	+	297	WP_001272251.1	hypothetical protein	-
OMP07_RS28310	97029..97850	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OMP07_RS28315	98147..98794	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OMP07_RS28320	99071..99454	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OMP07_RS28325	99735..100439	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2	-	1..155833	155833
	-	inside	IScluster/Tn	blaSHV-12	-	99735..128161	28426

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T273974 WP_001372321.1 NZ_CP119333:95582-95707 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT273974 NZ_CP119333:c95503-95438 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin