Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95438..95707 | Replicon | plasmid pWZ0036KPC |
| Accession | NZ_CP119333 | ||
| Organism | Klebsiella pneumoniae strain CQ22WZ0036 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OMP07_RS28295 | Protein ID | WP_001372321.1 |
| Coordinates | 95582..95707 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 95438..95503 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP07_RS28265 | 91148..91675 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OMP07_RS28270 | 91733..91966 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OMP07_RS28275 | 92027..94050 | + | 2024 | Protein_121 | ParB/RepB/Spo0J family partition protein | - |
| OMP07_RS28280 | 94119..94553 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OMP07_RS28285 | 94550..95269 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 95281..95505 | + | 225 | NuclAT_0 | - | - |
| - | 95281..95505 | + | 225 | NuclAT_0 | - | - |
| - | 95281..95505 | + | 225 | NuclAT_0 | - | - |
| - | 95281..95505 | + | 225 | NuclAT_0 | - | - |
| - | 95438..95503 | - | 66 | - | - | Antitoxin |
| OMP07_RS28290 | 95491..95640 | + | 150 | Protein_124 | plasmid maintenance protein Mok | - |
| OMP07_RS28295 | 95582..95707 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OMP07_RS28300 | 96026..96322 | - | 297 | Protein_126 | hypothetical protein | - |
| OMP07_RS28305 | 96622..96918 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OMP07_RS28310 | 97029..97850 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OMP07_RS28315 | 98147..98794 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OMP07_RS28320 | 99071..99454 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OMP07_RS28325 | 99735..100439 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..155833 | 155833 | |
| - | inside | IScluster/Tn | blaSHV-12 | - | 99735..128161 | 28426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T273974 WP_001372321.1 NZ_CP119333:95582-95707 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT273974 NZ_CP119333:c95503-95438 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|