Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59339..59592 | Replicon | plasmid pWZ0036KPC |
| Accession | NZ_CP119333 | ||
| Organism | Klebsiella pneumoniae strain CQ22WZ0036 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OMP07_RS28050 | Protein ID | WP_001312851.1 |
| Coordinates | 59443..59592 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59339..59398 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP07_RS28010 (55723) | 55723..56091 | + | 369 | Protein_68 | conjugal transfer protein TrbJ | - |
| OMP07_RS28015 (56206) | 56206..56412 | + | 207 | WP_171773970.1 | TraY domain-containing protein | - |
| OMP07_RS28020 (56474) | 56474..56842 | + | 369 | WP_004194426.1 | type IV conjugative transfer system pilin TraA | - |
| OMP07_RS28025 (56856) | 56856..57161 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| OMP07_RS28030 (57181) | 57181..57546 | + | 366 | Protein_72 | type IV conjugative transfer system protein TraE | - |
| OMP07_RS28035 (57601) | 57601..57945 | - | 345 | Protein_73 | IS6-like element IS26 family transposase | - |
| OMP07_RS28040 (57997) | 57997..58701 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OMP07_RS28045 (58806) | 58806..59138 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (59339) | 59339..59398 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59339) | 59339..59398 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59339) | 59339..59398 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59339) | 59339..59398 | - | 60 | NuclAT_1 | - | Antitoxin |
| OMP07_RS28050 (59443) | 59443..59592 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OMP07_RS28055 (59876) | 59876..60124 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OMP07_RS28060 (60369) | 60369..60443 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OMP07_RS28065 (60436) | 60436..61293 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OMP07_RS28070 (62232) | 62232..62885 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OMP07_RS28075 (62978) | 62978..63235 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OMP07_RS28080 (63168) | 63168..63569 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OMP07_RS28085 (63818) | 63818..64233 | + | 416 | Protein_83 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..155833 | 155833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T273970 WP_001312851.1 NZ_CP119333:59443-59592 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT273970 NZ_CP119333:c59398-59339 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
