Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 5436322..5436908 Replicon chromosome
Accession NZ_CP119332
Organism Klebsiella pneumoniae strain CQ22WZ0036

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OMP07_RS26830 Protein ID WP_002920800.1
Coordinates 5436540..5436908 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OMP07_RS26825 Protein ID WP_002920802.1
Coordinates 5436322..5436543 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMP07_RS26805 (OMP07_26805) 5432479..5433405 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OMP07_RS26810 (OMP07_26810) 5433402..5434679 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OMP07_RS26815 (OMP07_26815) 5434676..5435443 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OMP07_RS26820 (OMP07_26820) 5435445..5436158 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OMP07_RS26825 (OMP07_26825) 5436322..5436543 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OMP07_RS26830 (OMP07_26830) 5436540..5436908 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OMP07_RS26835 (OMP07_26835) 5437181..5438497 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OMP07_RS26840 (OMP07_26840) 5438604..5439491 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OMP07_RS26845 (OMP07_26845) 5439488..5440333 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OMP07_RS26850 (OMP07_26850) 5440335..5441405 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 5433402..5442142 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T273968 WP_002920800.1 NZ_CP119332:5436540-5436908 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT273968 WP_002920802.1 NZ_CP119332:5436322-5436543 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References