Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1248891..1249113 | Replicon | chromosome |
Accession | NC_017638 | ||
Organism | Escherichia coli DH1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | ECDH1ME8569_RS06175 | Protein ID | WP_000170955.1 |
Coordinates | 1248891..1248998 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1249046..1249113 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECDH1ME8569_RS06145 (ECDH1ME8569_1151) | 1244747..1245580 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
ECDH1ME8569_RS06150 (ECDH1ME8569_1152) | 1245577..1245969 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
ECDH1ME8569_RS06155 (ECDH1ME8569_1153) | 1245973..1246782 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
ECDH1ME8569_RS06160 (ECDH1ME8569_1154) | 1246818..1247672 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
ECDH1ME8569_RS06165 (ECDH1ME8569_1155) | 1247821..1247928 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
ECDH1ME8569_RS06170 (ECDH1ME8569_1156) | 1248356..1248463 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
ECDH1ME8569_RS06175 (ECDH1ME8569_1157) | 1248891..1248998 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
- | 1249046..1249113 | + | 68 | - | - | Antitoxin |
ECDH1ME8569_RS06180 (ECDH1ME8569_1158) | 1249402..1250502 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
ECDH1ME8569_RS06185 (ECDH1ME8569_1159) | 1250772..1251002 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
ECDH1ME8569_RS06190 (ECDH1ME8569_1160) | 1251160..1251855 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
ECDH1ME8569_RS06195 (ECDH1ME8569_1161) | 1251899..1252252 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
ECDH1ME8569_RS06200 (ECDH1ME8569_1162) | 1252437..1253831 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T27395 WP_000170955.1 NC_017638:c1248998-1248891 [Escherichia coli DH1]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T27395 NC_017638:c1248998-1248891 [Escherichia coli DH1]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT27395 NC_017638:1249046-1249113 [Escherichia coli DH1]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|