Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3603529..3604179 | Replicon | chromosome |
Accession | NZ_CP119319 | ||
Organism | MAG: Kluyvera intermedia isolate MAG 4159 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P0Y47_RS16455 | Protein ID | WP_279215769.1 |
Coordinates | 3603529..3603870 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P0Y47_RS16460 | Protein ID | WP_279215770.1 |
Coordinates | 3603880..3604179 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0Y47_RS16435 (3599815) | 3599815..3601206 | + | 1392 | WP_062776717.1 | hexose-6-phosphate:phosphate antiporter | - |
P0Y47_RS16440 (3601345) | 3601345..3602250 | - | 906 | WP_279215766.1 | LysR family transcriptional regulator | - |
P0Y47_RS16445 (3602356) | 3602356..3602808 | + | 453 | WP_062776721.1 | DUF1198 family protein | - |
P0Y47_RS16450 (3602911) | 3602911..3603435 | + | 525 | WP_279215767.1 | SRPBCC domain-containing protein | - |
P0Y47_RS16455 (3603529) | 3603529..3603870 | + | 342 | WP_279215769.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0Y47_RS16460 (3603880) | 3603880..3604179 | + | 300 | WP_279215770.1 | XRE family transcriptional regulator | Antitoxin |
P0Y47_RS16465 (3604285) | 3604285..3605472 | + | 1188 | WP_062776728.1 | purine ribonucleoside efflux pump NepI | - |
P0Y47_RS16470 (3605583) | 3605583..3606965 | - | 1383 | WP_279215771.1 | carbohydrate porin | - |
P0Y47_RS16475 (3607128) | 3607128..3607427 | - | 300 | WP_279215772.1 | PTS lactose/cellobiose transporter subunit IIA | - |
P0Y47_RS16480 (3607512) | 3607512..3608834 | - | 1323 | WP_062776734.1 | PTS transporter subunit EIIC | - |
P0Y47_RS16485 (3608848) | 3608848..3609162 | - | 315 | WP_279215773.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13059.95 Da Isoelectric Point: 6.0764
>T273947 WP_279215769.1 NZ_CP119319:3603529-3603870 [Kluyvera intermedia]
MWDVETTDVFDMWFEVQTAALKEDMLAAMLILSEYGPQLGRPFADTVNGSTFSNMKELRIQHQGHPIRAFFVFDPARHGI
VLCAGDKTGFNEKRFYKDMIKLADAEYRKHLNQ
MWDVETTDVFDMWFEVQTAALKEDMLAAMLILSEYGPQLGRPFADTVNGSTFSNMKELRIQHQGHPIRAFFVFDPARHGI
VLCAGDKTGFNEKRFYKDMIKLADAEYRKHLNQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|