Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 572557..573217 | Replicon | chromosome |
| Accession | NZ_CP119319 | ||
| Organism | MAG: Kluyvera intermedia isolate MAG 4159 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P0Y47_RS02405 | Protein ID | WP_279216392.1 |
| Coordinates | 572557..572910 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P0Y47_RS02410 | Protein ID | WP_062778255.1 |
| Coordinates | 572915..573217 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0Y47_RS02395 (569056) | 569056..569487 | + | 432 | WP_153742584.1 | universal stress protein | - |
| P0Y47_RS02400 (569535) | 569535..572225 | + | 2691 | WP_279216391.1 | cation-transporting P-type ATPase | - |
| P0Y47_RS02405 (572557) | 572557..572910 | + | 354 | WP_279216392.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0Y47_RS02410 (572915) | 572915..573217 | + | 303 | WP_062778255.1 | XRE family transcriptional regulator | Antitoxin |
| P0Y47_RS02415 (573561) | 573561..573923 | + | 363 | WP_153742588.1 | helix-turn-helix domain-containing protein | - |
| P0Y47_RS02420 (574066) | 574066..574851 | - | 786 | WP_153742589.1 | SDR family oxidoreductase | - |
| P0Y47_RS02425 (574987) | 574987..575472 | - | 486 | WP_153742590.1 | NAD(P)-binding domain-containing protein | - |
| P0Y47_RS02430 (575561) | 575561..577018 | - | 1458 | WP_279216393.1 | efflux transporter outer membrane subunit | - |
| P0Y47_RS02435 (577108) | 577108..577722 | + | 615 | WP_013575227.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13268.08 Da Isoelectric Point: 6.2818
>T273941 WP_279216392.1 NZ_CP119319:572557-572910 [Kluyvera intermedia]
VWTIKTTDGFDNWFSTLCATDRASVLASLLVLREKGPGLPRPYADTIKGSCYSNMKELRVQSQGDPIRVFFAFDPYRTGI
LLCAGNKVGNEKRFYNQMIAVADREFTDYLNTLDDKE
VWTIKTTDGFDNWFSTLCATDRASVLASLLVLREKGPGLPRPYADTIKGSCYSNMKELRVQSQGDPIRVFFAFDPYRTGI
LLCAGNKVGNEKRFYNQMIAVADREFTDYLNTLDDKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|