Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5363711..5364306 | Replicon | chromosome |
Accession | NZ_CP119298 | ||
Organism | Pseudomonas aeruginosa strain SNDPR-01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PZ484_RS24950 | Protein ID | WP_003117425.1 |
Coordinates | 5364028..5364306 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PZ484_RS24945 | Protein ID | WP_003099268.1 |
Coordinates | 5363711..5364016 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZ484_RS24910 | 5358851..5359699 | + | 849 | WP_003123430.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PZ484_RS24920 | 5359866..5360807 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PZ484_RS24925 | 5360924..5361538 | + | 615 | WP_031806327.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PZ484_RS24930 | 5361580..5362164 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PZ484_RS24935 | 5362205..5363305 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PZ484_RS24945 | 5363711..5364016 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PZ484_RS24950 | 5364028..5364306 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PZ484_RS24955 | 5364359..5364483 | - | 125 | Protein_4929 | integrase | - |
PZ484_RS24960 | 5364631..5366859 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PZ484_RS24965 | 5366929..5367576 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PZ484_RS24970 | 5367683..5368876 | - | 1194 | WP_213870760.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T273938 WP_003117425.1 NZ_CP119298:c5364306-5364028 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|