Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 143999..144584 Replicon plasmid pAP54-1
Accession NZ_CP119224
Organism Acinetobacter proteolyticus strain AP54

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag PY247_RS22360 Protein ID WP_000897307.1
Coordinates 144264..144584 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PY247_RS22355 Protein ID WP_000369781.1
Coordinates 143999..144271 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY247_RS22330 (PY247_22330) 139398..139727 + 330 WP_275574233.1 LysR family transcriptional regulator -
PY247_RS22335 (PY247_22335) 139771..140274 + 504 WP_275574234.1 LysR family substrate-binding domain-containing protein -
PY247_RS22340 (PY247_22340) 140207..140911 + 705 WP_004897650.1 IS6-like element IS1006 family transposase -
PY247_RS22345 (PY247_22345) 141093..141977 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
PY247_RS22350 (PY247_22350) 142033..143508 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
PY247_RS22355 (PY247_22355) 143999..144271 - 273 WP_000369781.1 NadS family protein Antitoxin
PY247_RS22360 (PY247_22360) 144264..144584 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PY247_RS22365 (PY247_22365) 144724..145143 + 420 WP_001180106.1 SMI1/KNR4 family protein -
PY247_RS22370 (PY247_22370) 145222..145503 - 282 WP_000985609.1 putative addiction module antidote protein -
PY247_RS22375 (PY247_22375) 145504..145806 - 303 WP_275574235.1 type II toxin-antitoxin system RelE/ParE family toxin -
PY247_RS22380 (PY247_22380) 145955..146485 + 531 WP_000172759.1 hypothetical protein -
PY247_RS22385 (PY247_22385) 146574..146888 - 315 WP_004728120.1 BrnA antitoxin family protein -
PY247_RS22390 (PY247_22390) 146875..147162 - 288 WP_000438825.1 BrnT family toxin -
PY247_RS22395 (PY247_22395) 147403..148173 - 771 WP_032073134.1 hypothetical protein -
PY247_RS22400 (PY247_22400) 148232..148570 + 339 WP_032073153.1 hypothetical protein -
PY247_RS22405 (PY247_22405) 148698..149402 - 705 WP_001067784.1 IS6-like element IS1006 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / qacE / aadA5 / aac(6')-IIa / blaIMP-1 / floR / mph(E) / msr(E) / sul2 / blaOXA-58 / dfrA1 / aph(3')-VIa - 1..248123 248123


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T273922 WP_000897307.1 NZ_CP119224:c144584-144264 [Acinetobacter proteolyticus]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT273922 WP_000369781.1 NZ_CP119224:c144271-143999 [Acinetobacter proteolyticus]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References