Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 102823..103249 | Replicon | plasmid p5 |
| Accession | NZ_CP119179 | ||
| Organism | Klebsiella pneumoniae strain X-CRHVKP-130 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PY995_RS29135 | Protein ID | WP_001372321.1 |
| Coordinates | 102823..102948 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 103025..103249 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY995_RS29100 (97878) | 97878..98105 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| PY995_RS29105 (98199) | 98199..98885 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| PY995_RS29110 (99076) | 99076..99459 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PY995_RS29115 (99736) | 99736..100383 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| PY995_RS29120 (100680) | 100680..101501 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| PY995_RS29125 (101612) | 101612..101908 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| PY995_RS29130 (102208) | 102208..102504 | + | 297 | Protein_120 | hypothetical protein | - |
| PY995_RS29135 (102823) | 102823..102948 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PY995_RS29140 (102890) | 102890..103039 | - | 150 | Protein_122 | plasmid maintenance protein Mok | - |
| - (103025) | 103025..103249 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103025) | 103025..103249 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103025) | 103025..103249 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103025) | 103025..103249 | - | 225 | NuclAT_0 | - | Antitoxin |
| PY995_RS29145 (103261) | 103261..103980 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| PY995_RS29150 (103977) | 103977..104411 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| PY995_RS29155 (104480) | 104480..106503 | - | 2024 | Protein_125 | ParB/RepB/Spo0J family partition protein | - |
| PY995_RS29160 (106564) | 106564..106797 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| PY995_RS29165 (106855) | 106855..107382 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| PY995_RS29170 (107684) | 107684..108139 | + | 456 | Protein_128 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 | - | 1..127419 | 127419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T273910 WP_001372321.1 NZ_CP119179:c102948-102823 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT273910 NZ_CP119179:c103249-103025 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
