Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 158569..159296 | Replicon | plasmid p4 |
| Accession | NZ_CP119178 | ||
| Organism | Klebsiella pneumoniae strain X-CRHVKP-130 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | PY995_RS28105 | Protein ID | WP_011251285.1 |
| Coordinates | 158569..158880 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PY995_RS28110 | Protein ID | WP_011251286.1 |
| Coordinates | 158877..159296 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY995_RS28065 (153580) | 153580..154074 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| PY995_RS28070 (154080) | 154080..154520 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| PY995_RS28075 (154945) | 154945..155901 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| PY995_RS28080 (155961) | 155961..156302 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| PY995_RS28085 (156316) | 156316..156627 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| PY995_RS28090 (156644) | 156644..157093 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| PY995_RS28100 (157927) | 157927..158364 | + | 438 | Protein_195 | DDE-type integrase/transposase/recombinase | - |
| PY995_RS28105 (158569) | 158569..158880 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PY995_RS28110 (158877) | 158877..159296 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PY995_RS28115 (159443) | 159443..160411 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| PY995_RS28120 (160483) | 160483..160848 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| PY995_RS28125 (160862) | 160862..161650 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| PY995_RS28130 (161671) | 161671..162291 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| PY995_RS28135 (162710) | 162710..163345 | + | 636 | WP_227661578.1 | hypothetical protein | - |
| PY995_RS28140 (163658) | 163658..164128 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..232058 | 232058 | |
| - | inside | IScluster/Tn | - | - | 151660..183702 | 32042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T273905 WP_011251285.1 NZ_CP119178:158569-158880 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT273905 WP_011251286.1 NZ_CP119178:158877-159296 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|