Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 46718..46971 Replicon plasmid p4
Accession NZ_CP119178
Organism Klebsiella pneumoniae strain X-CRHVKP-130

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PY995_RS27420 Protein ID WP_001312851.1
Coordinates 46822..46971 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 46718..46777 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY995_RS27380 (41975) 41975..42439 + 465 Protein_51 DUF4158 domain-containing protein -
PY995_RS27385 (42496) 42496..43200 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PY995_RS27390 (43225) 43225..43425 + 201 WP_072354025.1 hypothetical protein -
PY995_RS27395 (43445) 43445..44191 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
PY995_RS27400 (44246) 44246..44806 + 561 WP_000139328.1 fertility inhibition protein FinO -
PY995_RS27405 (44938) 44938..45138 + 201 WP_015059022.1 hypothetical protein -
PY995_RS27410 (45524) 45524..46123 + 600 WP_032083981.1 PIN domain-containing protein -
PY995_RS27415 (46185) 46185..46517 + 333 WP_152916585.1 hypothetical protein -
- (46718) 46718..46777 - 60 NuclAT_0 - Antitoxin
- (46718) 46718..46777 - 60 NuclAT_0 - Antitoxin
- (46718) 46718..46777 - 60 NuclAT_0 - Antitoxin
- (46718) 46718..46777 - 60 NuclAT_0 - Antitoxin
PY995_RS27420 (46822) 46822..46971 + 150 WP_001312851.1 Hok/Gef family protein Toxin
PY995_RS27425 (47255) 47255..47503 + 249 WP_000083837.1 replication regulatory protein RepA -
PY995_RS27430 (47748) 47748..47822 + 75 WP_001375168.1 RepA leader peptide Tap -
PY995_RS27435 (47815) 47815..48672 + 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
PY995_RS27440 (48940) 48940..49593 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
PY995_RS27445 (49686) 49686..49943 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
PY995_RS27450 (49876) 49876..50277 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
PY995_RS27455 (50526) 50526..50941 + 416 Protein_66 IS1-like element IS1B family transposase -
PY995_RS27460 (50977) 50977..51522 - 546 Protein_67 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..232058 232058
- inside IScluster/Tn cmlA1 / qacE / blaCTX-M-14 / blaKPC-2 / blaTEM-1B - 31..43200 43169


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T273901 WP_001312851.1 NZ_CP119178:46822-46971 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT273901 NZ_CP119178:c46777-46718 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References