Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 745678..746453 | Replicon | chromosome |
Accession | NZ_CP119174 | ||
Organism | Klebsiella pneumoniae strain X-CRHVKP-130 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | PY995_RS03725 | Protein ID | WP_004150910.1 |
Coordinates | 745968..746453 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | PY995_RS03720 | Protein ID | WP_004150912.1 |
Coordinates | 745678..745971 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY995_RS03700 (PY995_03700) | 740886..741488 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
PY995_RS03705 (PY995_03705) | 741586..742497 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
PY995_RS03710 (PY995_03710) | 742498..743646 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
PY995_RS03715 (PY995_03715) | 743657..745033 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
PY995_RS03720 (PY995_03720) | 745678..745971 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
PY995_RS03725 (PY995_03725) | 745968..746453 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
PY995_RS03730 (PY995_03730) | 747157..747750 | + | 594 | WP_004188553.1 | hypothetical protein | - |
PY995_RS03735 (PY995_03735) | 747847..748063 | + | 217 | Protein_734 | transposase | - |
PY995_RS03740 (PY995_03740) | 748669..749541 | + | 873 | WP_004188557.1 | ParA family protein | - |
PY995_RS03745 (PY995_03745) | 749541..749924 | + | 384 | WP_004150906.1 | hypothetical protein | - |
PY995_RS03750 (PY995_03750) | 749917..751284 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 747847..747999 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T273888 WP_004150910.1 NZ_CP119174:745968-746453 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |