Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 369459..370125 | Replicon | chromosome |
Accession | NZ_CP119165 | ||
Organism | Citrobacter freundii strain 2075 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P0S03_RS01770 | Protein ID | WP_172750178.1 |
Coordinates | 369808..370125 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | P0S03_RS01765 | Protein ID | WP_003837894.1 |
Coordinates | 369459..369755 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0S03_RS01750 (366635) | 366635..367108 | - | 474 | WP_283903385.1 | transcription elongation factor GreB | - |
P0S03_RS01755 (367334) | 367334..368053 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
P0S03_RS01760 (368050) | 368050..369402 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
P0S03_RS01765 (369459) | 369459..369755 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
P0S03_RS01770 (369808) | 369808..370125 | - | 318 | WP_172750178.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0S03_RS01775 (370248) | 370248..371870 | - | 1623 | WP_003023529.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
P0S03_RS01780 (372249) | 372249..373967 | + | 1719 | WP_172750179.1 | DUF4153 domain-containing protein | - |
P0S03_RS01785 (374077) | 374077..374955 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12238.14 Da Isoelectric Point: 10.0909
>T273870 WP_172750178.1 NZ_CP119165:c370125-369808 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDNIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDNIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|