Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 45036..45241 | Replicon | plasmid pCFSAN126951_03 |
| Accession | NZ_CP119162 | ||
| Organism | Enterococcus faecalis strain GENOMIC22-006 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | P0D81_RS16950 | Protein ID | WP_002387930.1 |
| Coordinates | 45140..45241 (-) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 45036..45100 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D81_RS16915 | 40371..40679 | - | 309 | Protein_48 | ATP-binding cassette domain-containing protein | - |
| P0D81_RS16920 | 40820..41500 | - | 681 | WP_002319817.1 | IS6-like element ISS1N family transposase | - |
| P0D81_RS16925 | 41537..41815 | - | 279 | WP_010778048.1 | hypothetical protein | - |
| P0D81_RS16930 | 41946..42959 | - | 1014 | WP_002396062.1 | replication initiator protein A | - |
| P0D81_RS16935 | 43218..43574 | - | 357 | WP_002360663.1 | hypothetical protein | - |
| P0D81_RS16940 | 43567..44349 | - | 783 | WP_002369746.1 | ParA family protein | - |
| P0D81_RS16945 | 44603..44899 | - | 297 | WP_010717413.1 | hypothetical protein | - |
| - | 45036..45100 | + | 65 | - | - | Antitoxin |
| P0D81_RS16950 | 45140..45241 | - | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| P0D81_RS16955 | 45332..45547 | - | 216 | WP_275527567.1 | excinuclease ABC subunit C | - |
| P0D81_RS16960 | 45504..45854 | - | 351 | WP_002395322.1 | hypothetical protein | - |
| P0D81_RS16965 | 45851..47020 | - | 1170 | WP_275527574.1 | Y-family DNA polymerase | - |
| P0D81_RS16970 | 47036..47641 | - | 606 | WP_000238804.1 | recombinase family protein | - |
| P0D81_RS16975 | 47772..48587 | + | 816 | WP_275527568.1 | DUF4158 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) | - | 1..70159 | 70159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T273866 WP_002387930.1 NZ_CP119162:c45241-45140 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
Antitoxin
Download Length: 65 bp
>AT273866 NZ_CP119162:45036-45100 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|