Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 45009..45241 | Replicon | plasmid pCFSAN126951_03 |
Accession | NZ_CP119162 | ||
Organism | Enterococcus faecalis strain GENOMIC22-006 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | P0D81_RS16950 | Protein ID | WP_002387930.1 |
Coordinates | 45140..45241 (-) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 45009..45100 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D81_RS16915 (40371) | 40371..40679 | - | 309 | Protein_48 | ATP-binding cassette domain-containing protein | - |
P0D81_RS16920 (40820) | 40820..41500 | - | 681 | WP_002319817.1 | IS6-like element ISS1N family transposase | - |
P0D81_RS16925 (41537) | 41537..41815 | - | 279 | WP_010778048.1 | hypothetical protein | - |
P0D81_RS16930 (41946) | 41946..42959 | - | 1014 | WP_002396062.1 | replication initiator protein A | - |
P0D81_RS16935 (43218) | 43218..43574 | - | 357 | WP_002360663.1 | hypothetical protein | - |
P0D81_RS16940 (43567) | 43567..44349 | - | 783 | WP_002369746.1 | ParA family protein | - |
P0D81_RS16945 (44603) | 44603..44899 | - | 297 | WP_010717413.1 | hypothetical protein | - |
- (45009) | 45009..45100 | + | 92 | NuclAT_0 | - | Antitoxin |
- (45009) | 45009..45100 | + | 92 | NuclAT_0 | - | Antitoxin |
- (45009) | 45009..45100 | + | 92 | NuclAT_0 | - | Antitoxin |
- (45009) | 45009..45100 | + | 92 | NuclAT_0 | - | Antitoxin |
P0D81_RS16950 (45140) | 45140..45241 | - | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
P0D81_RS16955 (45332) | 45332..45547 | - | 216 | WP_275527567.1 | excinuclease ABC subunit C | - |
P0D81_RS16960 (45504) | 45504..45854 | - | 351 | WP_002395322.1 | hypothetical protein | - |
P0D81_RS16965 (45851) | 45851..47020 | - | 1170 | WP_275527574.1 | Y-family DNA polymerase | - |
P0D81_RS16970 (47036) | 47036..47641 | - | 606 | WP_000238804.1 | recombinase family protein | - |
P0D81_RS16975 (47772) | 47772..48587 | + | 816 | WP_275527568.1 | DUF4158 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) | - | 1..70159 | 70159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T273864 WP_002387930.1 NZ_CP119162:c45241-45140 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
Antitoxin
Download Length: 92 bp
>AT273864 NZ_CP119162:45009-45100 [Enterococcus faecalis]
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|