Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 3041904..3042098 | Replicon | chromosome |
| Accession | NZ_CP119159 | ||
| Organism | Enterococcus faecalis strain GENOMIC22-006 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | P0D81_RS15105 | Protein ID | WP_015543884.1 |
| Coordinates | 3041904..3041999 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 3042034..3042098 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D81_RS15085 | 3037083..3038198 | + | 1116 | WP_002379062.1 | FAD-dependent oxidoreductase | - |
| P0D81_RS15090 | 3038265..3039419 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| P0D81_RS15095 | 3039434..3039871 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| P0D81_RS15100 | 3039886..3041658 | - | 1773 | WP_010706745.1 | PTS mannitol-specific transporter subunit IIBC | - |
| P0D81_RS15105 | 3041904..3041999 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 3042034..3042098 | - | 65 | - | - | Antitoxin |
| P0D81_RS15110 | 3042254..3042688 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| P0D81_RS15115 | 3042699..3044732 | - | 2034 | WP_002387671.1 | PRD domain-containing protein | - |
| P0D81_RS15120 | 3044723..3046465 | - | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T273862 WP_015543884.1 NZ_CP119159:3041904-3041999 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT273862 NZ_CP119159:c3042098-3042034 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|