Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 320334..320732 | Replicon | chromosome |
Accession | NZ_CP119159 | ||
Organism | Enterococcus faecalis strain GENOMIC22-006 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | P0D81_RS01630 | Protein ID | WP_021164545.1 |
Coordinates | 320334..320438 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 320578..320732 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D81_RS01620 | 315647..315790 | - | 144 | WP_002387585.1 | putative holin-like toxin | - |
P0D81_RS01625 | 316386..320144 | + | 3759 | WP_010706868.1 | WxL domain-containing protein | - |
P0D81_RS01630 | 320334..320438 | - | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
- | 320578..320732 | + | 155 | - | - | Antitoxin |
P0D81_RS01635 | 321040..322656 | - | 1617 | WP_002379014.1 | phosphatase PAP2/LCP family protein | - |
P0D81_RS01640 | 323118..324413 | + | 1296 | WP_002379013.1 | ATP-binding protein | - |
P0D81_RS01645 | 324422..325054 | + | 633 | WP_002358972.1 | RloB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T273850 WP_021164545.1 NZ_CP119159:c320438-320334 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
Antitoxin
Download Length: 155 bp
>AT273850 NZ_CP119159:320578-320732 [Enterococcus faecalis]
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|